KEGG   Salmonella enterica subsp. enterica serovar Bovismorbificans: BN855_7100Help
Entry
BN855_7100        CDS       T02827                                 

Gene name
sdhB
Definition
(GenBank) succinate dehydrogenase, Fe-S protein
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
senb  Salmonella enterica subsp. enterica serovar Bovismorbificans
Pathway
senb00020  Citrate cycle (TCA cycle)
senb00190  Oxidative phosphorylation
senb00650  Butanoate metabolism
senb01100  Metabolic pathways
senb01110  Biosynthesis of secondary metabolites
senb01120  Microbial metabolism in diverse environments
senb01130  Biosynthesis of antibiotics
senb01200  Carbon metabolism
Module
senb_M00009  Citrate cycle (TCA cycle, Krebs cycle)
senb_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
senb_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:senb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BN855_7100 (sdhB)
   00650 Butanoate metabolism
    BN855_7100 (sdhB)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    BN855_7100 (sdhB)
Enzymes [BR:senb01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     BN855_7100 (sdhB)
    1.3.5.4  fumarate reductase (quinol)
     BN855_7100 (sdhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_8 Fer4_10 Fer4_7 Fer4_9 Fer4_18 Fer4
Motif
Other DBs
NCBI-ProteinID: CDF52886
LinkDB All DBs
Position
744015..744734
Genome map
AA seq 239 aa AA seqDB search
MMKLEFSIYRYNPDVDNAPRMQDYTLEGEEGRDMMLLDALIQLKEKDPSLSFRRSCREGV
CGSDGLNMNGKNGLACITPISALTQPGKKIVIRPLPGLPVIRDLVVDMGQFYAQYEKIKP
YLLNNGQNPPAREHLQMPEQREKLDGLYECILCACCSTSCPSFWWNPDKFIGPAGLLAAY
RFLIDSRDTETDSRLEGMSDAFSVFRCHSIMNCVSVCPKGLNPTRAIGHIKSMLLQRSA
NT seq 720 nt NT seq  +upstreamnt  +downstreamnt
atgatgaaactcgaattttcgatttatcgttataacccggatgtcgataacgctccgcgt
atgcaggattacaccctggaaggcgaagaagggcgcgacatgatgctgctggatgcgtta
atccagcttaaagaaaaagatcccagcctttctttccgccgttcctgccgcgaaggtgtg
tgtggttctgatggtttgaatatgaacggtaagaatggtctggcctgtattacccctatt
tcggcgctgactcagccgggtaagaagattgtgattcgcccgctgcccggtttgccggtg
atccgcgatttggtggtagacatggggcaattctacgcacaatatgagaagattaagcct
tacttattgaataatgggcaaaatccaccggcacgtgagcatttacagatgccggagcag
cgtgaaaaactcgatgggctgtatgaatgtattctttgcgcctgttgctcaacatcctgc
ccgtcattctggtggaacccggataagtttatcggtccggcggggctgctcgcggcgtat
cgattcctgatcgatagtcgtgataccgagactgacagtcgtctggaagggatgagcgat
gcattcagcgtattccgctgtcacagcattatgaactgcgtcagtgtatgtcctaaggga
ctgaacccgacgcgcgctatcggccatattaagtcgatgctgttgcagcgtagcgcgtaa

DBGET integrated database retrieval system