KEGG   Salmonella enterica subsp. enterica serovar Bovismorbificans: BN855_7430Help
Entry
BN855_7430        CDS       T02827                                 

Gene name
gpmA
Definition
(GenBank) 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
senb  Salmonella enterica subsp. enterica serovar Bovismorbificans
Pathway
senb00010  Glycolysis / Gluconeogenesis
senb00260  Glycine, serine and threonine metabolism
senb00680  Methane metabolism
senb01100  Metabolic pathways
senb01110  Biosynthesis of secondary metabolites
senb01120  Microbial metabolism in diverse environments
senb01130  Biosynthesis of antibiotics
senb01200  Carbon metabolism
senb01230  Biosynthesis of amino acids
Module
senb_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
senb_M00002  Glycolysis, core module involving three-carbon compounds
senb_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:senb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BN855_7430 (gpmA)
  09102 Energy metabolism
   00680 Methane metabolism
    BN855_7430 (gpmA)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BN855_7430 (gpmA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:senb04131]
    BN855_7430 (gpmA)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:senb04147]
    BN855_7430 (gpmA)
Enzymes [BR:senb01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     BN855_7430 (gpmA)
Membrane trafficking [BR:senb04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    BN855_7430 (gpmA)
Exosome [BR:senb04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   BN855_7430 (gpmA)
  Exosomal proteins of melanoma cells
   BN855_7430 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: CDF52919
LinkDB All DBs
Position
complement(778906..779658)
Genome map
AA seq 250 aa AA seqDB search
MAVTKLVLVRHGESQWNKENRFTGWYDVDLSEKGVSEAKAAGKLLKEEGFSFDFAYTSVL
KRAIHTLWNVLDELDQAWLPVEKSWKLNERHYGALQGLNKAETAEKYGDEQVKQWRRGFA
VTPPELTKDDERYPGHDPRYAKLSEKELPLTESLALTIDRVIPYWNDTILPRMKSGERVI
IAAHGNSLRALVKYLDNMSEDEILELNIPTGVPLVYEFDENFKPLKHYYLGNADEIAAKA
AAVANQGKAK
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atggctgtaactaagctggttctggtacgtcacggtgaaagtcaatggaacaaagagaac
cgtttcaccggctggtatgatgttgacctgtctgaaaaaggcgtaagcgaagcaaaagca
gcgggtaaactgctaaaagaagaaggtttcagctttgattttgcctacacttccgtactg
aaacgcgctatccatacgctgtggaacgtactggatgaactggatcaggcgtggctgccg
gtggaaaaatcctggaaactcaatgaacgtcactatggtgcgttgcaggggctgaataaa
gcggaaacggcagaaaaatatggtgacgagcaggttaaacagtggcgccgcggttttgcc
gtgacgccgccggaactgactaaagatgatgagcgttatccgggtcacgatccacgttat
gccaaactgagcgagaaagagctgccgttgaccgaaagtctggcgctgaccatcgaccgc
gttattccttactggaacgacaccatcctgccgcgtatgaagagcggtgagcgcgtgatc
atcgccgctcacggtaactcattgcgtgcgctggtgaaatacctggataacatgagtgaa
gatgagattcttgagttaaacatcccgaccggcgtgccgctggtgtatgagttcgacgaa
aacttcaagccgctcaaacattactatctgggcaacgctgacgaaatcgctgcgaaagcg
gctgccgtggcgaatcagggtaaagcgaagtaa

DBGET integrated database retrieval system