KEGG   Salmonella enterica subsp. enterica serovar Tennessee: SEET0819_05050Help
Entry
SEET0819_05050    CDS       T03730                                 

Gene name
alr
Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
senc  Salmonella enterica subsp. enterica serovar Tennessee
Pathway
senc00473  D-Alanine metabolism
senc01100  Metabolic pathways
senc01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:senc00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    SEET0819_05050 (alr)
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    SEET0819_05050 (alr)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:senc01011]
    SEET0819_05050 (alr)
Enzymes [BR:senc01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     SEET0819_05050 (alr)
Peptidoglycan biosynthesis and degradation proteins [BR:senc01011]
 Precursor biosynthesis
  Racemase
   SEET0819_05050 (alr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: AHN78583
LinkDB All DBs
Position
1064134..1065213
Genome map
AA seq 359 aa AA seqDB search
MQAATVVINRRALRHNLQRLRELAPASKLVAVVKANAYGHGLLETARTLPDADAFGVARL
EEALRLRAGGITQPILLLEGFFDAADLPTISAQCLHTAVHNQEQLAALEAVELAEPVTVW
MKLDTGMHRLGVRPEEAEAFYQRLTHCKNVRQPVNIVSHFARADEPECGATEHQLDIFNA
FCQGKPGQRSIAASGGILLWPQSHFDWARPGIILYGVSPLEHKPWGPDFGFQPVMSLTSS
LIAVRDHKAGEPVGYGGTWVSERDTRLGVVAMGYGDGYPRAAPSGTPVLVNGREVPIVGR
VAMDMICVDLGPNAQDNAGDPVVLWGEGLPVERIAEMTKVSAYELITRLTSRVAMKYID
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atgcaagcggcaacagtcgtcattaaccgccgcgctctgcgacacaacctgcaacgtctg
cgtgaactggcgcctgccagtaagctggttgcggtggtgaaagcgaacgcttatggacac
ggtcttctggagaccgcgcgaacgctccctgatgctgacgcttttggcgtggcgcgtctt
gaagaggctctacgtctgcgagcgggcgggatcacgcagcctatcctgctgctggagggt
tttttcgacgccgccgatctgccgaccatttccgcgcaatgtctgcataccgccgtacat
aatcaggagcagcttgccgccctggaggcggtggagctggcggagccggtaacggtctgg
atgaaactggataccggtatgcatcgtctcggcgtgcgtcccgaagaggcggaggcgttc
taccagcgtctgacgcactgtaaaaatgtacgccagccggtgaatatcgtcagccatttt
gcccgtgcggatgagccggaatgcggcgctaccgaacatcagctcgacatttttaatgcc
ttctgtcagggtaaacccggtcagcgctctattgccgcgtctggcggtattctgctgtgg
ccgcagtctcactttgactgggcgcgtccgggcatcattttgtatggcgtatcgccgctg
gaacacaaaccctgggggcctgattttggttttcagccggtgatgtccttaacctccagt
ttgatcgcggtgcgtgaccacaaagcgggcgaaccggtgggttacggcgggacatgggtg
agtgagcgcgacacgcgcctgggcgtggtggcgatgggttatggcgatggctacccacga
gcggcgccttccggtacgccagtgctggtcaatggtcgtgaagtcccgattgtcgggcgg
gtggcgatggatatgatttgcgtagatttggggccaaacgcgcaggataacgcgggcgat
ccggtggtcttatggggtgaaggtctgccggttgaacgtatcgctgaaatgacaaaagta
agtgcttacgaacttatcacgcgcctgacctcaagggtggcgatgaagtatattgattaa

DBGET integrated database retrieval system