KEGG   Salmonella enterica subsp. enterica serovar Tennessee: SEET0819_06515Help
Entry
SEET0819_06515    CDS       T03730                                 

Definition
(GenBank) succinate-semialdehyde dehydrogenase
  KO
K00135  succinate-semialdehyde dehydrogenase / glutarate-semialdehyde dehydrogenase [EC:1.2.1.16 1.2.1.79 1.2.1.20]
Organism
senc  Salmonella enterica subsp. enterica serovar Tennessee
Pathway
senc00250  Alanine, aspartate and glutamate metabolism
senc00310  Lysine degradation
senc00350  Tyrosine metabolism
senc00650  Butanoate metabolism
senc00760  Nicotinate and nicotinamide metabolism
senc01100  Metabolic pathways
senc01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:senc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    SEET0819_06515
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SEET0819_06515
   00310 Lysine degradation
    SEET0819_06515
   00350 Tyrosine metabolism
    SEET0819_06515
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    SEET0819_06515
Enzymes [BR:senc01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.16  succinate-semialdehyde dehydrogenase [NAD(P)+]
     SEET0819_06515
    1.2.1.20  glutarate-semialdehyde dehydrogenase
     SEET0819_06515
    1.2.1.79  succinate-semialdehyde dehydrogenase (NADP+)
     SEET0819_06515
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AHN78855
LinkDB All DBs
Position
1384490..1385860
Genome map
AA seq 456 aa AA seqDB search
MAYQTVNPANNQLIKEYLPHTDADIEAALQKADALYHSDWSKGEIDQRLPVLHKLADLID
SRVEELAKIASQEMGKLIEQSRGEVKLCAQIARYYADNAKQFLAPVPYKTEFGDAWVEHH
PIGVIMAVEPWNFPYYQLMRVLAPNLAAGNPVLAKHASIVPHCAETFAHLVREAGAPEGA
WTNLFISSDQVANIIADPRVQGAALTGSEKAGSAVAAQAAKHIKKSTLELGGNDVFVVLD
DADLEKAVKIGVQARLTNAGQVCTAAKRFILHEKIADQFLSQFTEAFRKVKVGDQMDAST
ELGPLSSKDALDTLTRQVEEAVKNGATLHVGGKPLESKGNFFEPTILTHITRDNPAYFEE
FFGPVAQMYVVKDDDEAVKLANDSHYGLGGAVFSQDIERAKRMASRIETGMVYINWLTDT
AAELPFGGVKRSGFGRELSDLGIKEFVNQKLVVVRR
NT seq 1371 nt NT seq  +upstreamnt  +downstreamnt
atggcttaccagacagtgaatcctgccaataatcagctcattaaagagtacctcccgcac
acggacgcggatattgaagccgcgctgcaaaaagctgacgcgctctatcactccgattgg
tccaaaggagagattgaccaacgtctgccggtactgcataagctggctgacttgatcgac
agccgtgttgaagaactggcaaaaatcgccagccaggagatgggcaagctcatcgagcag
agccgtggcgaagtcaaactgtgtgcgcagatcgctcgctattatgcggataacgcgaag
cagtttcttgccccggtgccttataaaaccgagtttggcgacgcgtgggtagaacatcat
ccgattggcgtcatcatggctgttgagccgtggaacttcccgtactatcagttgatgcgt
gtgctggcgccgaacctggccgctggtaacccggtgctggcgaaacatgccagcatcgta
ccgcactgcgccgagacgtttgcccatctggtgcgtgaagccggcgcgccggaaggcgca
tggaccaacctgtttatttcctccgatcaggtagcgaacatcatcgccgacccgcgcgtg
cagggcgcggcgctgaccggatctgaaaaagcggggagcgccgtggcggcacaggcggcg
aagcacattaaaaaatcgacgctggaactgggcgggaacgatgtgttcgtcgtgctggac
gatgccgatcttgagaaagcggtgaaaattggcgtgcaggcacggctcactaatgcgggg
caggtatgtacggcggcgaagcgctttatcctgcatgagaaaatcgccgatcaattcctc
agccagttcaccgaggcgttcaggaaggtgaaggtgggggatcagatggacgcttctacc
gaactcgggccgctgtcgtcgaaagatgctctggatacactgaccagacaggtcgaggaa
gcggtgaaaaatggcgcgacgctgcacgttggcggcaagccgctagaaagcaaaggcaac
ttctttgagccgaccattctgacccacattacgcgtgacaacccggcgtactttgaagag
ttcttcggcccggtggcgcagatgtatgtggtgaaagacgatgacgaggcggtaaaactc
gccaacgattcccactacggccttggcggcgcggtgtttagtcaggatattgagcgtgct
aaacgcatggcctcccggattgaaaccgggatggtttatatcaactggctgaccgacacc
gcagcggagctgccgttcggcggcgttaagcgttcgggcttcggacgcgagctatcggat
ctggggattaaggagtttgtgaaccagaagctggtagtggtgcgccgctaa

DBGET integrated database retrieval system