KEGG   Salmonella enterica subsp. enterica serovar Tennessee: SEET0819_07880Help
Entry
SEET0819_07880    CDS       T03730                                 

Gene name
mrcB
Definition
(GenBank) bifunctional glycosyl transferase/transpeptidase
  KO
K05365  penicillin-binding protein 1B [EC:2.4.1.129 3.4.16.4]
Organism
senc  Salmonella enterica subsp. enterica serovar Tennessee
Pathway
senc00550  Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:senc00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    SEET0819_07880 (mrcB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:senc01003]
    SEET0819_07880 (mrcB)
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:senc01011]
    SEET0819_07880 (mrcB)
Enzymes [BR:senc01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.129  peptidoglycan glycosyltransferase
     SEET0819_07880 (mrcB)
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     SEET0819_07880 (mrcB)
Glycosyltransferases [BR:senc01003]
 Polysaccharide
  Bacterial polysaccharide
   SEET0819_07880 (mrcB)
Peptidoglycan biosynthesis and degradation proteins [BR:senc01011]
 Peptidoglycan biosynthesis and degradation
  Glycosyltransferase/DD-Transpeptidase (Class A PBP)
   SEET0819_07880 (mrcB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transgly PBP1_TM Transpeptidase UB2H UvrB_inter DUF3484
Motif
Other DBs
NCBI-ProteinID: AHN79117
LinkDB All DBs
Position
1690456..1692978
Genome map
AA seq 840 aa AA seqDB search
MAGNDREPIGRKGKPSRPVKQKVSRRRQHDDDYDDDYEDEEPMPRKGKGKGRKPRGKRGW
LWLLLKLFIVFVVLFAIYGVYLDQKIRSRIDGKVWQLPAAVYGRMVNLEPDMPVSKNEMV
KLLEATQYRLVTKMTRPGEFTVQANSIEMIRRPFDFPDSKEGQVRARLTFSDGRLETIVN
LDNNRQFGFFRLDPRLITMLSSPNGEQRLFVPRSGFPDLLVDTLLATEDRHFYEHDGISL
YSIGRAVLANLTAGRTVQGASTLTQQLVKNLFLSSERSYWRKANEAYMALIMDARYSKDR
ILELYMNEVYLGQSGDNEIRGFPLASLYYFGRPVEELSLDQQALLVGMVKGASIYNPWRN
PKLALERRNLVLRLLQQQKIIDQELYDMLSARPLGVQPRGGVISPQPAFMQMVRQELQAK
LGDKIKDLSGVKIFTTFDSVAQDAAEKAVVEGIPALKKQRKLSDLETAMVVVDRFSGEVR
AMVGGAEPQYAGYNRAMQARRSIGSLAKPATYLTALSQPNLYRLNTWIADAPISLRQPNG
QVWSPQNDDRRYSESGKVMLVDALTRSMNVPTVNLGMALGLPAVTDTWTKLGVPKDQLNP
VPAMLLGALNLTPIEVAQAFQTIASGGNRAPLSALRSVIAEDGKVLYQSYPQAERAVPAQ
AAYLTLWTMQQVVQRGTGRQLGAKYPGLHLAGKTGTTNNNVDTWFAGIDGSQVTITWVGR
DNNQPTKLYGASGAMAIYQRYLANQTPTPLVLTPPEDVVDMGVDYDGNFVCSGGMRTLPV
WTDDPNTLCQQGEMMQQQQQPSGNPFDQSSQPQQPAQQQPPKEEKSDGVAGWIKEMFGGN
NT seq 2523 nt NT seq  +upstreamnt  +downstreamnt
atggcggggaatgaccgcgagccgattggacgtaaggggaaaccgtcacgtcctgtgaaa
caaaaggtgagccgtcgtcggcagcatgacgacgattatgatgatgactatgaggatgaa
gaaccgatgccgcgtaaaggtaagggcaaagggcgtaagcctcgtggcaagcgcggctgg
ctgtggctattgctaaaactgtttatcgtttttgtggtgctgttcgccatttacggcgtc
tatctggatcaaaaaatccgcagccgtattgatggcaaggtctggcagcttccggcggcg
gtatatggccggatggtgaaccttgagccagacatgcctgtcagcaaaaacgagatggtg
aaattgctggaagcgacgcagtatcgtctggtgacgaagatgacccgtcccggcgaattt
accgtgcaggccaatagcattgagatgatccgtcgtccgtttgacttcccggacagcaaa
gaagggcaggtgcgcgcgcggctgacgttcagtgacgggcgtctggaaaccatcgtcaat
ctggataacaaccgccagtttggcttcttccgcctcgatccgcggcttatcaccatgctt
tcttcgccaaatggcgagcagcgtttattcgtcccgcgcagcggtttcccggatctgctg
gtcgatacgctgttggcgacggaagaccgtcatttctatgagcatgatggcattagtctt
tactctatcgggcgtgcggtactggccaacctgacggcgggacgtacggtgcagggggcc
agtacgctaacccagcagctggtgaagaacctgttcctctccagcgaaagatcatactgg
cgtaaagcgaatgaagcctacatggcgctgatcatggatgcccgttacagtaaagatcgt
attcttgagctgtacatgaacgaggtctacctcggtcaaagcggggataatgaaattcgc
ggttttcctctggcgagcctgtattactttggtcgtccggtagaggaactgagcctcgat
cagcaggcgttactggtggggatggtaaaaggggcgtcgatttataacccgtggcgcaac
ccgaaactggcgctggagcgtcgtaacctggtgctacgcctgttacagcagcagaaaatc
atcgatcaggaactctatgacatgctgagcgcgcgtccgcttggcgtacagccgcgcggc
ggcgttatttcaccgcagccagcgtttatgcagatggttcgtcaggaactgcaggcgaag
ctgggggataaaattaaagatctctccggcgtgaagatcttcaccacctttgactccgtg
gcgcaggatgccgcagaaaaagccgttgtcgaaggcattccggcgttgaagaagcagcgt
aaattgagcgatctggaaaccgcgatggtggtagtggatcgctttagcggcgaggtgcgc
gcgatggttggcggggcggagccgcagtatgccggctataaccgtgccatgcaggcgcgc
cgttccatcgggtcgctggcgaaaccggcgacctatctgaccgcgttaagtcagccgaac
ttataccgtctgaacacctggattgccgatgcgccgatttctctgcgccagccgaatggt
caggtctggtcgccgcagaacgacgatcgtcgctacagcgaaagcgggaaagtgatgctg
gtggatgcgttaactcgctcaatgaacgtaccgacggtcaatctggggatggcgttaggt
ttaccggcggtaaccgatacctggacgaagctcggcgtgccgaaagatcagctcaatccg
gttccggcgatgctgttaggggcgctgaacctgacgccgatcgaagtggcgcaggcgttc
cagactatcgccagcggcggaaatcgcgcgccgttatcagcgctgcgttcagttattgcg
gaagatggtaaagtgctgtaccaaagttatccgcaagctgaacgcgccgtaccggcacag
gcggcttacctgacgctctggacaatgcagcaggtcgtccagcgtggtacggggcgtcag
cttggcgcgaaatatccgggtctgcatctggcgggtaaaaccgggacgacaaacaacaat
gtcgatacctggtttgccggtatcgacggcagccaggtgactatcacctgggtaggccgt
gataacaaccagccgacgaaattgtacggtgccagcggcgcgatggcgatttaccagcgc
tatctggcgaaccagacgccgacgcctttagttctgacgccgccggaagatgtggtggat
atgggcgttgattacgacggtaattttgtctgtagcggcggtatgcgcactctgccggtc
tggacggacgatccaaatacgctgtgccagcagggcgagatgatgcagcagcaacagcag
ccgtcaggcaatccgttcgatcagtcgtctcagccgcagcagcctgcgcagcaacagccg
ccgaaagaagagaagagcgacggcgttgccggctggattaaggagatgttcggcggcaat
taa

DBGET integrated database retrieval system