KEGG   Salmonella enterica subsp. enterica serovar Tennessee: SEET0819_08860Help
Entry
SEET0819_08860    CDS       T03730                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
senc  Salmonella enterica subsp. enterica serovar Tennessee
Pathway
senc00473  D-Alanine metabolism
senc00550  Peptidoglycan biosynthesis
senc01100  Metabolic pathways
senc01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:senc00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    SEET0819_08860
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    SEET0819_08860
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    SEET0819_08860
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:senc01011]
    SEET0819_08860
Enzymes [BR:senc01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     SEET0819_08860
Peptidoglycan biosynthesis and degradation proteins [BR:senc01011]
 Precursor biosynthesis
  Amino acid ligase
   SEET0819_08860
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2 ATP-grasp_4 ATP-grasp_3 ATPgrasp_ST RimK GARS_A
Motif
Other DBs
NCBI-ProteinID: AHN79297
LinkDB All DBs
Structure
PDB: 

Position
complement(1908943..1910037)
Genome map
AA seq 364 aa AA seqDB search
MAKLRVGIVFGGKSAEHEVSLQSAKNIVDAIDKTRFDVVLLGIDKAGQWHVNDAENYLQN
ADDPAHIALRPSAISLAQVPGKHQHQLINAQNGQPLPTVDVIFPIVHGTLGEDGSLQGML
RVANLPFVGSDVLSSAACMDKDVAKRLLRDAGLNIAPFITLTRTNRHAFSFAEVESRLGL
PLFVKPANQGSSVGVSKVTNEAQYQQAVALAFEFDHKVVVEQGIKGREIECAVLGNDNPQ
ASTCGEIVLNSEFYAYDTKYIDDNGAQVVVPAQIPSEVNDKIRAIAIQAYQTLGCAGMAR
VDVFLTADNEVVINEINTLPGFTNISMYPKLWQASGLGYTDLISRLIELALERHTANNAL
KTTM
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atggcgaaattgcgggtaggaatagtatttggcggtaagtcggcggaacatgaagtgtct
ttgcaatcagcgaaaaatatcgttgatgcgatcgataaaacccgcttcgacgtggtgctg
ttagggatagataaggcaggacaatggcatgttaacgatgcggaaaattatttgcagaat
gcagacgatccggcacatatcgcgctacgtccttcggcaatcagtctggcccaggtgcct
ggcaaacaccaacaccaattgattaacgcccaaaacgggcagccgctaccgacggtagat
gttatttttcctatcgtccacggtacgctgggcgaagacggctcattgcaggggatgctg
cgcgtcgcaaacttaccgtttgtcggttcagacgtgctgagctccgcagcctgcatggat
aaagacgtcgccaaacgactgctacgcgatgcaggactgaatatcgccccgtttattaca
ctcacccgaacgaatcgtcacgcgtttagttttgccgaggttgaatcccgtctgggactg
ccgctgttcgttaagcccgccaatcagggctcttcggtgggcgttagtaaagtcactaac
gaagcgcaatatcagcaggcggtcgcgctggctttcgaattcgatcataaagtggtggtg
gagcaagggatcaaagggcgcgagatcgaatgcgccgtattaggtaacgataacccacag
gccagtacctgcggcgaaatcgtactgaatagcgaattttacgcctacgatactaagtat
attgatgataacggcgcacaagttgtcgtgcctgcgcagatcccttccgaggtgaatgac
aagatccgcgcgattgcgatccaggcttatcagacgctggggtgcgcgggtatggcgcgt
gtcgatgtcttcttaacggcagacaatgaggtcgtgattaacgagattaatacgctgcca
ggttttaccaatatcagtatgtatccaaaactctggcaggcgagcggattgggctatacc
gatttgattagtcgcctgattgagctggcgctggaacgccatacggcgaataacgcctta
aaaaccacgatgtaa

DBGET integrated database retrieval system