KEGG   Salmonella enterica subsp. enterica serovar Tennessee: SEET0819_19840Help
Entry
SEET0819_19840    CDS       T03730                                 

Definition
(GenBank) beta-lactamase
  KO
K21469  serine-type D-Ala-D-Ala carboxypeptidase [EC:3.4.16.4]
Organism
senc  Salmonella enterica subsp. enterica serovar Tennessee
Pathway
senc00550  Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:senc00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    SEET0819_19840
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:senc01002]
    SEET0819_19840
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:senc01011]
    SEET0819_19840
Enzymes [BR:senc01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     SEET0819_19840
Peptidases and inhibitors [BR:senc01002]
 Serine peptidases
  Family S12: D-Ala-D-Ala carboxypeptidase B family
   SEET0819_19840
Peptidoglycan biosynthesis and degradation proteins [BR:senc01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   SEET0819_19840
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta-lactamase
Motif
Other DBs
NCBI-ProteinID: AHN81366
LinkDB All DBs
Position
4100586..4101884
Genome map
AA seq 432 aa AA seqDB search
MKFTLVATVLLTFSLSAFAVEYPVLTTASPDQEGFDSQKLHRLDGWIQNQIDAGYPSINL
LVIKDNHIVLQKAWGYAKKYDGSTLLAHPIRATTNTMYDLASNTKMYATNFALQKLVYEG
KIDVNDLVSKYIPGFKDMPGDKIKGKDKLRIIDILHHVAGFPADPQYPNKNVAGKLFSQS
KSTTLEMIKKTPLEYQPGSKHIYSDVDYMILGFIIESITAMPLDRYVETTIYKPLGLKHT
VFNPLMKGFTPPQIAATELHGNTRDGVIHFPNIRTNTLWGQVHDEKAWYSMGGVSGHAGL
FSDTHDMAVLMQVMLNGGGYGNVKLFDDKTVAQFTRRSPEDATFGLGWRVNGNASMTPTF
GVLASPQTYGHTGWTGTLTSIDPVNHMAIVILGNRPHSPVANPKVNPNVFVSGLLPAATY
GWIVDQIYGSLK
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atgaaatttactctcgttgcgacggttctactgacgttttccctttcagcttttgccgtt
gagtatccggtattgaccaccgcgagccctgatcaggaggggtttgatagccaaaaactt
caccgacttgatggctggattcaaaatcaaattgatgccggatatcccagcatcaatctt
ctggtgataaaagataatcatattgttctacaaaaagcctggggctatgccaaaaaatat
gacggttccacgctgttagcccatcccattcgggcgaccactaacacgatgtatgatctg
gcttcaaacacaaaaatgtatgccactaacttcgcattgcaaaaactagtgtatgaagga
aaaatagatgtcaatgatttggtatcaaaatatatccccggctttaaggatatgcctggg
gataaaataaaaggcaaagataaactccgcattattgatattcttcatcacgtcgcgggc
tttcctgccgacccacaatatcccaataaaaacgtcgccggtaaattattttcacagagt
aaaagcactactctggagatgattaaaaagacaccgctggaatatcaacctgggtcgaag
catatctacagcgacgtggattatatgattcttggttttatcattgaatcgataacggca
atgccattagatcgctacgtcgaaaccaccatttataaaccgctcggattaaaacatacc
gtctttaacccgctgatgaaaggcttcacgccgccgcaaatcgccgcaacggaactacat
ggcaacacgcgtgacggcgtgattcatttccccaatattcgcaccaatacactatggggc
caggtgcatgatgaaaaagcctggtactcaatgggcggcgtttcaggacacgccggactg
ttttctgacacccatgatatggctgtgttaatgcaagtcatgctcaatgggggcggctac
ggtaacgtgaagctattcgacgacaaaacggttgcgcagtttactcgccgctcgccagaa
gacgctacctttggtctggggtggcgcgttaacggcaacgcctcaatgacccccacgttc
ggggtattagccagtccgcaaacgtatggacataccggatggaccggcacgctgacgtct
atcgatccggttaatcatatggcgattgtgattttaggtaacaggccgcactcgccggta
gcaaatcctaaagtgaatccgaatgtttttgtcagtggattattacctgcggcgacgtat
ggctggattgttgaccagatatatggttccttaaaataa

DBGET integrated database retrieval system