KEGG   Salmonella enterica subsp. enterica serovar Tennessee: SEET0819_22530Help
Entry
SEET0819_22530    CDS       T03730                                 

Definition
(GenBank) adenine glycosylase
  KO
K03575  A/G-specific adenine glycosylase [EC:3.2.2.31]
Organism
senc  Salmonella enterica subsp. enterica serovar Tennessee
Pathway
senc03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:senc00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    SEET0819_22530
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:senc03400]
    SEET0819_22530
Enzymes [BR:senc01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.31  adenine glycosylase
     SEET0819_22530
DNA repair and recombination proteins [BR:senc03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     SEET0819_22530
 Prokaryotic type
     SEET0819_22530
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NUDIX_4 HhH-GPD HHH EndIII_4Fe-2S
Motif
Other DBs
NCBI-ProteinID: AHN81874
LinkDB All DBs
Position
4691694..4692746
Genome map
AA seq 350 aa AA seqDB search
MQASQFSAQVLDWYDKYGRKTLPWQINKTPYKVWLSEVMLQQTQVTTVIPYFERFMARFP
TVTDLANAPLDEVLHLWTGLGYYARARNLHKAAQQVATLHGGEFPQTFAEIAALPGVGRS
TAGAILSLALGKHYPILDGNVKRVLARCYAVSGWPGKKEVENTLWTLSEQVTPARGVERF
NQAMMDLGAMVCTRSKPKCTLCPLQNGCIAAAHESWSRYPGKKPKQTLPERTGYFLLLQH
NQEIFLAQRPPSGLWGGLYCFPQFASEDELREWLAQRHVNADNLTQLNAFRHTFSHFHLD
IVPMWLPVSSLDACMDEGSALWYNLAQPPSVGLAAPVERLLQQLRTGAPV
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgcaagcgtctcaattttcagcccaggttctggactggtacgacaaatacgggcggaaa
acgctgccctggcaaattaacaagacgccttacaaagtatggctctcggaagtcatgttg
caacaaacgcaggtgacaacggtgattccttactttgagcgatttatggcgcgctttccc
acggtgacggatttagcgaatgcgccgctggatgaagtgctccatttatggaccgggctc
ggctattacgcccgcgcgcgtaatttgcataaagcggcgcaacaggtggcgacgcttcac
ggtggagaattcccgcaaacttttgccgaaatcgccgcgctacccggcgtcgggcgttca
accgccggcgcgattctctccctcgcgttaggtaaacattatccgattcttgatggaaac
gttaaacgtgtgctggctcgctgttatgctgttagcggctggcctggaaaaaaagaggtg
gagaatacgctgtggacgctgagcgagcaagtgacgcccgcacgcggcgtggagcgtttt
aatcaggcgatgatggatctgggcgcgatggtttgtacgcgttcaaagccaaagtgcacc
ctgtgtccgctgcaaaacggttgtatcgccgctgcgcatgaaagctggtcacgctatccg
ggcaagaaaccgaaacagacgttgccggagcggacgggttactttttattgttacagcat
aatcaggagattttcctggcgcagcgccctcccagcggtttatggggcggactctactgc
ttcccgcagttcgccagcgaagatgaattacgtgaatggctggcgcaacggcatgttaac
gctgataatttgacccagcttaacgcgtttcgccacacatttagccatttccacctggat
attgtgcctatgtggcttcccgtgtcgtcactggacgcctgcatggatgaaggcagcgcg
ctctggtataacttagcgcaaccgccgtcagtcggactggcggcccccgtggagcgcttg
ttacagcagttacgtaccggagcgccagtttaa

DBGET integrated database retrieval system