KEGG   Salmonella enterica subsp. enterica serovar Typhimurium DT104: DT104_02151Help
Entry
DT104_02151       CDS       T02874                                 

Gene name
yaeG
Definition
(GenBank) conserved hypothetical protein
  KO
K02647  carbohydrate diacid regulator
Organism
send  Salmonella enterica subsp. enterica serovar Typhimurium DT104
Brite
KEGG Orthology (KO) [BR:send00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:send03000]
    DT104_02151 (yaeG)
Transcription factors [BR:send03000]
 Prokaryotic Type
  Helix-turn-helix
   Other families
    DT104_02151 (yaeG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Diacid_rec HTH_30 GGDEF_2 GAF_2
Motif
Other DBs
NCBI-ProteinID: CCW72932
UniProt: A0A0U1FT30
LinkDB All DBs
Position
246076..247233
Genome map
AA seq 385 aa AA seqDB search
MAGWHLDTKMAQDIVARTMRIIDTNINVMDARGRIIGSGDRERIGELHEGALLVLSQGRV
VDIDDAVARHLHGVRQGINLPLRLEGEIVGVIGLTGEPEHLRKYGELVCMTAEMMLEQSR
LMHLLAQDSRLREELVMNLIQAEENTPALVEWAQRLGIDLNQPRVAAVVEVDSGQLGVDS
AMAELQQLQNALTTPERNNLIAIVSLTEMVVLKPALNSFGRWDAEDHRKRVEQLISRMKE
NGQLRFRVALGNYFTGPGSIARSYRTARTTMMVGKQRMPESRSYFYQDLMLPVLLDSLRG
GWQANELARPLVKLKAMDNNGLLRRTLTAWFRHNVQPLATSKALFIHRNTLEYRLNRISE
LTGLDLGNFDDRLLLYVALQLDEQR
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atggctggctggcatcttgataccaaaatggcgcaggatatcgtggcgcgcactatgcgc
atcatcgataccaatatcaacgtaatggatgcccgcgggcgcattatcggcagcggcgat
cgggaacgtattggtgaattgcacgaaggcgcgctgttagtgctgtcgcagggccgggtt
gtggatatcgacgacgccgtggcgcgacacctgcacggggtgcgtcaggggattaatctt
cccttacgtcttgagggcgaaattgtcggcgtgatcggcctcaccggcgaaccagagcac
ctgcgtaaatatggcgaactggtgtgtatgactgccgaaatgatgctggagcagtcgcgg
ttaatgcaccttttggcgcaggatagccgtttgcgcgaagagttggtgatgaacctgatt
caggccgaagaaaatacgccggcgctggtggaatgggcgcagcgtttggggatcgatttg
aaccagccgcgtgtggcggcggtggtggaagtcgacagcggccagcttggcgtcgatagc
gcaatggcggaacttcagcagttgcagaatgcgcttaccacgccggagcgtaacaacctg
atagccattgtttctctcaccgagatggtggtactcaaacccgccttaaactcgtttggt
cgttgggatgctgaagatcatcgtaagcgcgtagagcagcttatctcgcgcatgaaagag
aatggtcagctacgttttcgcgtggcgctgggcaattactttaccgggccgggcagtatt
gcacgctcataccgcacggcgcgcaccacgatgatggtcggcaaacagcgaatgccagag
agccgcagctatttttatcaggatttgatgctgccggtcctgttagatagcctgcgtggc
ggctggcaggccaatgagctggcgcgcccgctggtaaaactcaaagcgatggataacaac
gggttattacgtcggacgctgacggcgtggtttcgccataatgtccagccgctggcgacc
tctaaggcgctgtttattcatcgtaacacgctggaatatcggctaaatcgtatttcggaa
ctgaccgggctggatttgggaaattttgacgatcggctgttgctgtatgtggcgctacaa
ctggatgaacagcgttaa

DBGET integrated database retrieval system