KEGG   Salmonella enterica subsp. enterica serovar Typhimurium DT104: DT104_10211Help
Entry
DT104_10211       CDS       T02874                                 

Gene name
sodCI
Definition
(GenBank) phage encoded superoxide dismutase [cu-zn] 1 precursor
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
send  Salmonella enterica subsp. enterica serovar Typhimurium DT104
Brite
Enzymes [BR:send01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     DT104_10211 (sodCI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-ProteinID: CCW73733
UniProt: A0A0T9VT89
LinkDB All DBs
Structure
PDB: 

Position
complement(1111011..1111544)
Genome map
AA seq 177 aa AA seqDB search
MKYTILSLVAGALISCSAMAENTLTVKMNDALSSGTGENIGEITVSETPYGLLFTPHLNG
LTPGIHGFHVHTNPSCMPGMKDGKEVPALMAGGHLDPEKTGKHLGPYNDKGHLGDLPGLV
VNADGTATYPLLAPRLKSLSELKGHSLMIHKGGDNYSDKPAPLGGGGARFACGVIEK
NT seq 534 nt NT seq  +upstreamnt  +downstreamnt
atgaaatacacaatattgtcgctggtagctggtgcgctcatcagttgttcagcaatggca
gagaataccctgactgtaaagatgaacgatgccctgtccagcggaacaggagaaaacata
ggtgaaatcacagtttcagagacaccttacggtctgcttttcactcctcacctaaatggt
cttacgccaggaattcacggcttccatgtccacacaaacccaagttgtatgccgggaatg
aaagacggtaaagaggttccggcgctcatggccggaggacatcttgaccccgaaaaaacc
gggaaacatcttggcccatataatgacaaagggcatttgggggatctgcctggactggtt
gtcaatgcagatggtacagccacgtatccgttactggcaccacgccttaaatcactgtca
gaactgaaaggtcactcattgatgatccataaaggcggtgacaattactccgataaacct
gctccactgggtggtggcggtgcacgttttgcctgtggtgtcattgagaaataa

DBGET integrated database retrieval system