KEGG   Salmonella enterica subsp. enterica serovar Typhimurium DT104: DT104_26351
Entry
DT104_26351       CDS       T02874                                 

Definition
(GenBank) leucine rich hypothetical protein
  KO
K23942  Gifsy-1 prophage leucine-rich repeat protein
Organism
send  Salmonella enterica subsp. enterica serovar Typhimurium DT104
Pathway
send05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:send00001]
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    DT104_26351
SSDB
Motif
Pfam: FNIP LRR_4
Other DBs
NCBI-ProteinID: CCW75336
LinkDB
Position
2797168..2798661
AA seq 497 aa
MTYRLKKRMKIGFQPAILQYAYTSNEATSNLELLNKWRIESPDIEKEERNSIYDKIIEAN
HTGSLSITAHHVTSIPVFPDNLSELNLSSCYTLESIPNLPDGLKSLTISGNQTIKISYFP
DSLESLSIDMQAYEENYTFPALPYGLKSFTACYGKFLPPLPPHLSSLSLQNFSEILCAEL
PYKLDKLDLQNCPFLPLMKMLPEELKELSIELIRTVPGTVIDDILPDKLKKLSINFCDNI
KLPVKLPVNLKSINLSSRTPIAWEIPTCNLPAHIDISTDGYVKLNPEFLTRSDITFSNKP
AGDVLSFQPGDVVYGLCKARDRVNTLVNSLYYFSKKDIIIQNTLTDAVWDRKNRAVFNKD
EKIAERLNDVQRGIFFREFLSQHKKYNITEDKYSDLSNEECWIKTSKAGLEFQTRLRERS
VIFVIDNLVDAISDIANKTGKHGNSITAHELRWVYRNRHDDLVKQNVKFFLNGEAISHED
VFSLVGWDKYKPKNRNR
NT seq 1494 nt   +upstreamnt  +downstreamnt
ttgacatatagattgaaaaagcgcatgaaaataggattccaaccagccatattgcaatat
gcatatacaagtaacgaggcgacatcaaaccttgagttattaaataaatggagaatagaa
tccccagatattgagaaggaggagcgtaatagtatttacgacaaaataatagaagcaaat
cataccgggagcttatcaattactgctcatcatgttacctctattccggtatttcctgat
aatttatccgagttgaatttatcttcatgctatacactggagtctattccaaatcttcct
gatgggttaaaaagtttaactatatctggaaatcagaccattaaaatttcatatttccca
gatagcttagagtcactatctatagatatgcaggcatatgaagaaaattatactttcccc
gcattaccttatggattaaagagttttactgcatgctatggtaaatttttgcctcccctt
cctccgcatctatcttctttgtcattgcaaaatttctctgaaatattatgtgctgagtta
ccatataaattagataaattagatttacaaaattgccctttcttgccattaatgaaaatg
ttacctgaggagttaaaagaactaagtattgaacttatacgaacagttcccggtactgtt
atagatgatattttgcctgataagctaaaaaaattaagtatcaacttttgtgataatatt
aaacttccagttaagcttcctgttaatttaaagtctatcaatttatcctcaaggacccct
attgcatgggaaataccaacctgcaatctgcctgcacatatagatattagtaccgatggt
tatgttaagcttaatcctgaatttcttaccaggagtgatattacctttagtaacaaacct
gcaggagatgtgttaagttttcagcctggagatgtggtttatggtttatgtaaggcaaga
gatcgagtaaatactttagttaattcgttatattatttttcaaaaaaagatattattatt
caaaatacattaacagatgcggtctgggacaggaagaatagagccgtgtttaataaagat
gagaagatagcagaaagattgaatgatgttcagagagggattttttttagagaattttta
tctcaacataaaaaatacaatattaccgaagataaatattcagacttatccaatgaggag
tgctggataaaaacaagtaaagccggtcttgaatttcaaacacgattgagggaacggtca
gttatttttgtcattgacaatttagttgatgctataagtgatatcgcaaataaaacagga
aagcatggtaattctattacagcacatgagctaagatgggtatatcggaatcgacatgat
gatctggtaaaacaaaatgttaaattttttcttaatggtgaggctatttcacacgaagat
gttttttcattagttggttgggataaatataagcctaaaaatagaaatcgttga

DBGET integrated database retrieval system