KEGG   Salmonella enterica subsp. enterica serovar Typhimurium DT104: DT104_44661
Entry
DT104_44661       CDS       T02874                                 

Gene name
holC
Definition
(GenBank) DNA polymerase III, chi subunit
  KO
K02339  DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
send  Salmonella enterica subsp. enterica serovar Typhimurium DT104
Pathway
send03030  DNA replication
send03430  Mismatch repair
send03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:send00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    DT104_44661 (holC)
   03430 Mismatch repair
    DT104_44661 (holC)
   03440 Homologous recombination
    DT104_44661 (holC)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:send03032]
    DT104_44661 (holC)
   03400 DNA repair and recombination proteins [BR:send03400]
    DT104_44661 (holC)
Enzymes [BR:send01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     DT104_44661 (holC)
DNA replication proteins [BR:send03032]
 Prokaryotic type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     DT104_44661 (holC)
DNA repair and recombination proteins [BR:send03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    DNA polymerase III holoenzyme
     DT104_44661 (holC)
SSDB
Motif
Pfam: DNA_pol3_chi
Other DBs
NCBI-ProteinID: CCW77162
LinkDB
Position
complement(4796065..4796547)
AA seq 160 aa
MTTHLNPPQEAPYMKNATFYLLDNDTTVNGLSAVEQLVCEIAAERWRAGKRVLIACEDEK
QAIRLDEALWARPAESFVPHNLAGEGPRGGAPVEIAWPQKRNSSPRDILISLRTSFADFA
TAFTEVVDFVPYEETLKQLARERYKAYRVAGFNLNTATWK
NT seq 483 nt   +upstreamnt  +downstreamnt
atgacaacgcatttaaatccaccacaagaagccccatatatgaaaaatgcgacgttctat
cttctggataatgacaccaccgtcaacggtttaagcgccgttgaacaactggtgtgtgaa
attgccgcagaacgttggcgcgcgggcaagcgcgtgctgatcgcctgcgaagatgagaag
caggccattcggctggatgaagcgctgtgggcaagaccggcggaaagttttgtcccgcac
aatctggcaggcgaaggcccacgcggcggcgcgccggttgaaatcgcctggccgcaaaaa
cgcaacagcagcccgcgcgatattttaatcagcctgcgtacaagctttgcagattttgcc
accgctttcacagaagtggtagacttcgtcccttacgaagaaactttgaaacaactggcg
cgcgaacgctacaaagcctaccgcgtggctggttttaacctgaatacggcaacctggaaa
taa

DBGET integrated database retrieval system