KEGG   Salmonella enterica subsp. enterica serovar Thompson: IA1_03335Help
Entry
IA1_03335         CDS       T02868                                 

Definition
(GenBank) D-alanyl-D-alanine carboxypeptidase
  KO
K07258  serine-type D-Ala-D-Ala carboxypeptidase (penicillin-binding protein 5/6) [EC:3.4.16.4]
Organism
sene  Salmonella enterica subsp. enterica serovar Thompson
Pathway
sene00550  Peptidoglycan biosynthesis
sene01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sene00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    IA1_03335
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:sene01002]
    IA1_03335
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:sene01011]
    IA1_03335
Enzymes [BR:sene01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     IA1_03335
Peptidases and inhibitors [BR:sene01002]
 Serine peptidases
  Family S11: D-Ala-D-Ala carboxypeptidase A family
   IA1_03335
Peptidoglycan biosynthesis and degradation proteins [BR:sene01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   IA1_03335
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S11 PBP5_C Beta-lactamase2 Beta-lactamase
Motif
Other DBs
NCBI-ProteinID: AGX09864
LinkDB All DBs
Position
complement(718928..720139)
Genome map
AA seq 403 aa AA seqDB search
MKTTFSARFMQRMALTTALCAAFISTAHADDLNIKTMIPGVPQIDAESYILIDYNSGKVL
AEQNADERRDPASLTKMMTSYVIGQAMKAGKFKETDLVTVGNDAWATGNPVFKGSSLMFL
KPGMQVPVSQLIRGINLQSGNDACVAMADFAAGSQDAFVGLMNSYVNALGLKNTHFQTVH
GLDADGQYSSARDMALIGQALIRDVPNEYAVYKEKEFTFNGIRQLNRNGLLWDNSLNVDG
IKTGHTSKAGYNLVASATEGQMRLISAVMGGRTYKGRETESKKLLTWGFRFFETVNPLKA
GKEFASEPAWFGNTDRASLGVDKDVYLTIPRGRMKDLKASYVLNTAELHAPLQKNQVVGT
INFQLDGKTIEQRPLVVLQEIPEGNFFGKIIDYIKLMFHHWFG
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgaagaccactttttccgctcgttttatgcagcgcatggcgctcaccacggcgctttgt
gccgcgtttatctcaaccgcacatgccgatgacctgaatatcaaaactatgatcccgggc
gttccgcagatcgatgcggaatcctacatcctgatcgactacaactccggcaaagttctg
gcggaacaaaacgccgacgaacgtcgcgacccggctagtctgacaaagatgatgaccagt
tacgtcatcggacaggcaatgaaagcgggtaaatttaaagaaaccgacctggttaccgtc
ggtaatgacgcctgggccaccggcaatccggtatttaaaggttcctcgctgatgttcctc
aaaccgggaatgcaggtaccggtctctcagttgatacgcggcatcaatctgcaatccggc
aatgacgcctgtgtggcgatggctgatttcgccgccggtagccaggatgctttcgtcggg
ctgatgaacagctatgtgaacgcgttggggctgaaaaatacccacttccagaccgtacac
ggcctggacgccgacggacaatacagttcagctcgcgatatggcgctgattggccaggcg
ttaattcgcgatgtgcctaacgaatatgccgtttataaagaaaaagagttcacctttaac
ggcattcgccagttaaaccgtaacggtctgctgtgggataacagcctgaatgtggacggc
atcaaaaccggccataccagcaaagcgggctataatctggtcgcttccgcaaccgaaggc
cagatgcggttgatttccgccgtaatgggcggacgaacctataaaggccgtgaaacagaa
agcaaaaaactgctgacgtggggcttccgtttctttgaaaccgttaatccgctgaaggct
ggtaaagagttcgcctctgaacccgcctggtttggtaataccgatcgcgcctcgctgggc
gtcgataaagacgtttacctgacgatccctcgcggtcgcatgaaagatttgaaagcgagc
tatgtactgaataccgcagaactgcacgcgccgctgcagaaaaaccaggtagtcggcacc
atcaacttccagctggacggtaaaaccatcgagcagcgtccgctggtcgtactgcaagag
atcccggaagggaacttcttcggtaaaatcattgattacattaaattaatgttccatcac
tggtttggataa

DBGET integrated database retrieval system