KEGG   Salmonella enterica subsp. enterica serovar Thompson: IA1_05900Help
Entry
IA1_05900         CDS       T02868                                 

Definition
(GenBank) 3-oxoacyl-ACP synthase
  KO
K09458  3-oxoacyl-[acyl-carrier-protein] synthase II [EC:2.3.1.179]
Organism
sene  Salmonella enterica subsp. enterica serovar Thompson
Pathway
sene00061  Fatty acid biosynthesis
sene00780  Biotin metabolism
sene01100  Metabolic pathways
sene01212  Fatty acid metabolism
Module
sene_M00083  Fatty acid biosynthesis, elongation
sene_M00572  Pimeloyl-ACP biosynthesis, BioC-BioH pathway, malonyl-ACP => pimeloyl-ACP
Brite
KEGG Orthology (KO) [BR:sene00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    IA1_05900
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    IA1_05900
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:sene01004]
    IA1_05900
Enzymes [BR:sene01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.179  beta-ketoacyl-[acyl-carrier-protein] synthase II
     IA1_05900
Lipid biosynthesis proteins [BR:sene01004]
 Fatty acid synthase
  Component type
   IA1_05900
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ketoacyl-synt Ketoacyl-synt_C Thiolase_N ACP_syn_III KAsynt_C_assoc
Motif
Other DBs
NCBI-ProteinID: AGX10271
LinkDB All DBs
Position
1246474..1247715
Genome map
AA seq 413 aa AA seqDB search
MSKRRVVVTGLGMLSPVGNTVESTWKALLAGQSGISLIDHFDTSAYATKFAGLVKDFNCD
DIISRKEQRKMDAFIQYGIVAGVQAMQDSGLEVTEENASRIGAAIGSGIGGLGLIEENHS
SLVKGGPRKISPFFVPSTIVNMVAGHLTIMYGLRGPSISIATACTSGVHNIGHAARIIAY
GDADAMVAGGAEKASTPLGVGGFGAARALSTRNDNPQAASRPWDKERDGFVLGDGAGMLV
LEEYEHAKARGAKIYAEIVGFGMSSDAYHMTSPPENGAGAALAMVNALRDAAIEPAQIGY
VNAHGTSTPAGDKAETQAVKSVFGDAASRVMVSSTKSMTGHLLGAAGAVESIFSILALRD
QAIPPTINLDNPDEGCDLDFVPHEARQVSDLEYALCNSFGFGGTNGSLIFKKI
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
gtgtctaagcgtcgtgtagttgtgaccggactgggcatgttgtctcctgtcggcaatacc
gtagagtctacctggaaagctctccttgccggtcagagtggcatcagcctgatcgaccat
ttcgatactagcgcctatgcaacgaaatttgctggcttagtaaaggattttaactgtgat
gacattatctcgcgcaaagaacagcgcaagatggatgccttcattcaatatggaattgtc
gctggcgtacaggccatgcaggattctggccttgaagtgacggaagagaacgcaagccgt
attggcgccgctatcggctccggtatcggtggtctcggtctgatcgaagaaaaccacagt
tcgctggtaaaaggcggaccgcgtaagattagcccgttctttgtcccgtcgacgattgtt
aacatggtagcaggccatctgactatcatgtatggcctgcgtgggccaagcatctctatt
gcgactgcctgtacttcaggcgtgcataacatcggccatgccgcgcgtatcatcgcctat
ggcgatgcggacgcgatggtggcaggtggcgcagaaaaagccagtacgccgctgggtgta
ggtggttttggcgcagcgcgcgcgctgtcgacccgcaacgataacccacaggcggcaagc
cgtccgtgggataaagaacgcgatggttttgtactgggcgacggtgccggtatgttggtg
cttgaagagtacgaacatgcgaaagcgcgtggtgcgaaaatctatgctgaaatcgtcggc
tttggtatgagcagcgatgcttaccatatgacgtcgccgccggaaaatggcgcaggcgct
gcgctggcgatggttaacgcgttgcgtgatgccgcgattgagcctgctcagattggctac
gtcaacgcgcacggcacgtcgacgcctgccggcgacaaagctgagacgcaggcggttaag
tcagtctttggcgatgccgcaagccgagtgatggtgagctcgaccaaatcgatgaccggc
catctgttgggcgccgcaggcgcagtagagtctattttctctattctggcgctacgcgat
caggccattccgccaaccattaatctggataacccggatgaaggttgcgatctggacttc
gtgccgcatgaagcgcgccaggtcagcgatctggagtacgctctgtgtaactcctttggc
tttggcggaactaacggttccttgatctttaaaaagatctaa

DBGET integrated database retrieval system