KEGG   Salmonella enterica subsp. enterica serovar Thompson: IA1_16385Help
Entry
IA1_16385         CDS       T02868                                 

Definition
(GenBank) acetyl-CoA carboxylase biotin carboxylase subunit
  KO
K01961  acetyl-CoA carboxylase, biotin carboxylase subunit [EC:6.4.1.2 6.3.4.14]
Organism
sene  Salmonella enterica subsp. enterica serovar Thompson
Pathway
sene00061  Fatty acid biosynthesis
sene00620  Pyruvate metabolism
sene00640  Propanoate metabolism
sene01100  Metabolic pathways
sene01110  Biosynthesis of secondary metabolites
sene01120  Microbial metabolism in diverse environments
sene01130  Biosynthesis of antibiotics
sene01200  Carbon metabolism
sene01212  Fatty acid metabolism
Module
sene_M00082  Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:sene00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    IA1_16385
   00640 Propanoate metabolism
    IA1_16385
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    IA1_16385
Enzymes [BR:sene01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     IA1_16385
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     IA1_16385
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CPSase_L_D2 Biotin_carb_N Biotin_carb_C ATP-grasp_3 Dala_Dala_lig_C ATP-grasp GARS_A ATP-grasp_4
Motif
Other DBs
NCBI-ProteinID: AGX11938
LinkDB All DBs
Position
3411145..3412494
Genome map
AA seq 449 aa AA seqDB search
MLDKIVIANRGEIALRILRACKELGIKTVAVHSSADRDLKHVLLADETVCIGPAPSVKSY
LNIPAIISAAEITGAVAIHPGYGFLSENANFAEQVERSGFIFIGPKADTIRLMGDKVSAI
TAMKKAGVPTVPGSDGPLGDDMNANRAHAKRIGYPVIIKASGGGGGRGMRVVRSDAELAQ
SISMTKAEAKAAFSNDMVYMEKYLENPRHIEIQVLADGQGNAIYLAERDCSMQRRHQKVV
EEAPAPGITPELRRYIGERCAKACVDIGYRGAGTFEFLFENGEFYFIEMNTRIQVEHPVT
EMITGVDLIKEQLRIAAGQPLSITQDEVVVRGHAVECRINAEDPNTFLPSPGKITRFHAP
GGFGVRWESHIYAGYTVPPYYDSMIGKLICYGENRDVAIARMKNALQELIIDGIKTNIDL
QTRIMNDEHFQHGGTNIHYLEKKLGLQEK
NT seq 1350 nt NT seq  +upstreamnt  +downstreamnt
atgttggataaaattgtcatcgccaaccgtggcgagatcgcactacgtattcttcgagcc
tgtaaagaactcggcatcaagaccgtcgctgtgcactcaagcgcggatcgcgatttaaaa
cacgtattgctggcggatgagacggtctgtattggtccggcaccgtccgtaaaaagttat
ctgaacatcccggctatcattagcgccgctgaaatcaccggcgcggtggcaatccacccg
ggttacggcttcctttctgagaacgccaattttgccgagcaggttgaacgctccggcttt
atctttatcggcccgaaagcggacaccatccgcctgatgggcgataaagtgtccgcgatt
accgcgatgaaaaaagcgggcgtgccgaccgtaccaggatctgacggcccgctgggcgac
gatatgaatgcgaaccgcgctcatgccaaacgtattggctatccggtgatcatcaaagcg
tccggcggcggcggcggccgcggtatgcgcgtggttcgtagcgatgctgaactggcgcag
tccatctccatgaccaaagcggaagcgaaagcagctttcagcaacgacatggtatacatg
gaaaaatacctggaaaatccacgccacatcgaaattcaggtgctggcggacggccagggc
aacgctatctatctggcggaacgcgactgttccatgcagcgtcgccaccagaaagtggtt
gaagaagccccggcgccaggcattacgccggaactgcgtcgctatatcggcgaacgctgc
gcgaaagcgtgcgtagacatcggctatcgcggcgcagggacgttcgaattcctgttcgaa
aacggcgagttctatttcatcgaaatgaacacccgtattcaggttgaacacccggtgact
gaaatgattactggcgtcgatttgatcaaagagcagttgcgcatcgcggcgggtcagccg
ctgtcgatcacacaggacgaagttgtcgttcgaggccatgcggtagaatgccgtatcaat
gccgaagatccgaacaccttcctgccaagccctggcaaaatcacgcgcttccatgcgcct
ggcggctttggcgttcgctgggaatctcatatctacgcgggctacacggtgccgccgtac
tatgattccatgatcggcaagctcatctgctacggtgaaaaccgcgatgtggcgattgcc
cgtatgaaaaatgccctgcaggaactgattatcgatggtatcaaaaccaatatcgatctg
cagacccgcatcatgaatgacgagcacttccagcacggtggaaccaacatccactatctg
gagaaaaaactcggtcttcaggaaaagtaa

DBGET integrated database retrieval system