KEGG   Salmonella enterica subsp. enterica serovar Heidelberg CFSAN002069: CFSAN002069_04980Help
Entry
CFSAN002069_04980 CDS       T02735                                 

Gene name
gpmA
Definition
(GenBank) phosphoglyceromutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
senh  Salmonella enterica subsp. enterica serovar Heidelberg CFSAN002069
Pathway
senh00010  Glycolysis / Gluconeogenesis
senh00260  Glycine, serine and threonine metabolism
senh00680  Methane metabolism
senh01100  Metabolic pathways
senh01110  Biosynthesis of secondary metabolites
senh01120  Microbial metabolism in diverse environments
senh01130  Biosynthesis of antibiotics
senh01200  Carbon metabolism
senh01230  Biosynthesis of amino acids
Module
senh_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
senh_M00002  Glycolysis, core module involving three-carbon compounds
senh_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:senh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CFSAN002069_04980 (gpmA)
  09102 Energy metabolism
   00680 Methane metabolism
    CFSAN002069_04980 (gpmA)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CFSAN002069_04980 (gpmA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:senh04131]
    CFSAN002069_04980 (gpmA)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:senh04147]
    CFSAN002069_04980 (gpmA)
Enzymes [BR:senh01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     CFSAN002069_04980 (gpmA)
Membrane trafficking [BR:senh04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    CFSAN002069_04980 (gpmA)
Exosome [BR:senh04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   CFSAN002069_04980 (gpmA)
  Exosomal proteins of melanoma cells
   CFSAN002069_04980 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: AGQ77027
LinkDB All DBs
Position
complement(1361592..1362344)
Genome map
AA seq 250 aa AA seqDB search
MAVTKLVLVRHGESQWNKENRFTGWYDVDLSEKGVSEAKAAGKLLKEEGFSFDFAYTSVL
KRAIHTLWNVLDELDQAWLPVEKSWKLNERHYGALQGLNKAETAEKYGDEQVKQWRRGFA
VTPPELTKDDERYPGHDPRYAKLSEKELPLTESLALTIDRVIPYWNDTILPRMKSGERVI
IAAHGNSLRALVKYLDNMSEDEILELNIPTGVPLVYEFDENFKPLKHYYLGNADEIAAKA
AAVANQGKAK
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atggctgtaactaagctggttctggtacgtcacggtgaaagtcaatggaacaaagagaac
cgtttcaccggctggtatgatgttgacctgtctgaaaaaggcgtaagcgaagcaaaagca
gcgggtaaactgctaaaagaagaaggtttcagctttgattttgcctacacttccgtactg
aaacgcgctatccatacgctgtggaacgtactggatgaactggatcaggcgtggctgccg
gtggaaaaatcctggaaactcaatgaacgtcactatggcgcgttgcaggggctgaataaa
gcggaaacggcagaaaaatatggtgacgagcaggttaaacagtggcgccgcggttttgcc
gtgacgccgccggaactgactaaagatgatgagcgttatccgggtcacgatccacgttat
gccaaactgagcgagaaagagctgccgttgaccgaaagtctggcgctgaccatcgaccgc
gttattccttactggaacgacaccatcctgccgcgtatgaagagcggtgagcgcgtgatc
atcgccgctcacggtaactcattgcgtgcgctggtgaaatacctggataacatgagtgaa
gatgagatccttgagttaaacatcccgaccggcgtgccgctggtgtatgagttcgacgaa
aacttcaagccgctcaaacattactatctgggcaacgctgacgaaatcgccgcgaaagcg
gctgccgtggcgaatcagggtaaagcgaagtaa

DBGET integrated database retrieval system