KEGG   Salmonella enterica subsp. enterica serovar Heidelberg CFSAN002069: CFSAN002069_06970Help
Entry
CFSAN002069_06970 CDS       T02735                                 

Definition
(GenBank) beta-lactam binding protein AmpH
  KO
K18988  serine-type D-Ala-D-Ala carboxypeptidase/endopeptidase [EC:3.4.16.4 3.4.21.-]
Organism
senh  Salmonella enterica subsp. enterica serovar Heidelberg CFSAN002069
Brite
KEGG Orthology (KO) [BR:senh00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:senh01002]
    CFSAN002069_06970
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:senh01011]
    CFSAN002069_06970
Enzymes [BR:senh01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     CFSAN002069_06970
   3.4.21  Serine endopeptidases
    3.4.21.-  
     CFSAN002069_06970
Peptidases and inhibitors [BR:senh01002]
 Serine peptidases
  Family S12: D-Ala-D-Ala carboxypeptidase B family
   CFSAN002069_06970
Peptidoglycan biosynthesis and degradation proteins [BR:senh01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   CFSAN002069_06970
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta-lactamase Peptidase_S11
Motif
Other DBs
NCBI-ProteinID: AGQ77346
LinkDB All DBs
Position
complement(954149..955306)
Genome map
AA seq 385 aa AA seqDB search
MKRSLLFTAMLFAASLTSVQAAQPIADPVFASDIVDRYAEHIFYGSGATGMALVVIDGNQ
RVFRSFGDTRPGNNVRPQLDSVIRIASLTKLMTSEMLVKLLDQGTVKLNDPLSKYAPPGA
RVPTYQGTPITLVNLATHTSALPREQPGGAAHRPVFVWPTREQRWNWLSTATLKVAPGSQ
AAYSNLAFDLLADALATASGKPYTQLFEEKITRPLGMKDTTFTPSPDQCKRLMVAEKGAS
PCNNTLAAIGSGGVYSTPGDMMRWMQQYLSSDFYHRSQQADRMQTLIYQRTQLKKIIGMD
VPGKADALGLGWVYMAPKDGRPGIIQKTGGGGGFITYMAMIPQYNIGAFVVVTRSPLTRF
TNMSDGINDLVTELSGNKPIAIPAS
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
ttgaaacgtagtctgctttttactgccatgctgtttgcggcatcacttacttctgtccag
gcggctcagccgattgccgatccggtttttgcctctgatatcgttgatcgttatgccgag
catatcttttatggtagcggcgccacgggcatggcgctggtggtgatcgacggcaatcaa
cgcgtgtttcgtagtttcggtgacaccagaccgggcaataatgttcgtccacagcttgat
tcggtcattcgtatcgcttctctcaccaagctcatgaccagtgaaatgttggtaaaattg
ctcgatcagggaacggtaaaattaaacgatccgctcagcaaatatgcgcctcccggcgcg
cgtgtcccgacgtatcaaggcacgccgattacgttggtcaacttagcgacccacaccagc
gcgcttccgcgagaacagcccggcggcgcggcgcatcgtccggtatttgtctggccaacc
cgcgaacaacgctggaactggctctccacagcaacgttaaaagtcgcgcccggttcacag
gcggcctattccaatctggcgttcgacctgttagccgacgcgctggcgaccgcctccggc
aaaccttatacgcaactgtttgaagaaaagattacccgcccgctgggaatgaaagacacc
acgtttaccccttctcccgatcagtgtaagcgtctgatggtggcagaaaaaggcgcaagc
ccctgtaataatacgctggcagccattggcagcggtggggtctattctacgccaggagat
atgatgcgctggatgcaacagtatctgtcgtcagatttctatcaccgtagccaacaggcc
gatcgtatgcaaacgttgatttatcagcgcacacagttaaagaaaatcatcgggatggac
gtaccgggtaaagccgacgcgctcggtctgggctgggtctatatggcgccaaaagacgga
cgtcctggcattatccagaaaacaggaggcggcggcggttttattacctatatggcgatg
atcccgcaatataatattggcgcttttgtggtcgtaacccgttcccccctcacgcgtttt
accaatatgagcgacgggattaacgatttggttactgagctaagcggcaataaaccgatt
gctattcctgcatcctga

DBGET integrated database retrieval system