KEGG   Salmonella enterica subsp. enterica serovar Heidelberg CFSAN002069: CFSAN002069_14740Help
Entry
CFSAN002069_14740 CDS       T02735                                 

Gene name
aroK
Definition
(GenBank) shikimate kinase
  KO
K00891  shikimate kinase [EC:2.7.1.71]
Organism
senh  Salmonella enterica subsp. enterica serovar Heidelberg CFSAN002069
Pathway
senh00400  Phenylalanine, tyrosine and tryptophan biosynthesis
senh01100  Metabolic pathways
senh01110  Biosynthesis of secondary metabolites
senh01130  Biosynthesis of antibiotics
senh01230  Biosynthesis of amino acids
Module
senh_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:senh00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CFSAN002069_14740 (aroK)
Enzymes [BR:senh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.71  shikimate kinase
     CFSAN002069_14740 (aroK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SKI AAA_33 AAA_18 Cytidylate_kin2 Cytidylate_kin dNK AAA AAA_16 APS_kinase TsaE AAA_22 ABC_tran AAA_7 AAA_17 AAA_5 Ploopntkinase3 RNA_helicase AAA_PrkA AAA_25 AAA_28 AAA_29 RsgA_GTPase His_biosynth PduV-EutP Mg_chelatase AAA_2 AAA_24 IstB_IS21 AAA_14
Motif
Other DBs
NCBI-ProteinID: AGQ78524
LinkDB All DBs
Position
complement(4057020..4057541)
Genome map
AA seq 173 aa AA seqDB search
MAEKRNIFLVGPMGAGKSTIGRQLAQQLNMEFYDSDQEIEKRTGADVGWVFDVEGEDGFR
NREEKVINELTEKQGIVLATGGGSVKSRETRNRLSARGVVVYLETTIEKQLARTQRDKKR
PLLQVEAPPREVLEALANERNPLYEEIADVTIRTDDQSAKVVANQIIHMLESN
NT seq 522 nt NT seq  +upstreamnt  +downstreamnt
atggcagagaaacgcaatatctttctggttgggcctatgggtgccggaaaaagcactatt
gggcgccagttagctcaacaactcaatatggaattttacgattctgatcaagagattgag
aaacgaaccggagctgatgtgggctgggtcttcgatgttgaaggtgaagacggcttccgt
aatcgtgaagaaaaagttatcaacgaattgacggaaaaacagggtattgtgctggcaacc
ggcggtggctctgtaaaatcgcgtgaaacgcgtaaccgtctctccgcgcgtggcgtcgtg
gtctaccttgaaacgaccatcgaaaaacaactggcgcgcacgcagcgtgataaaaaacgc
ccgctgttgcaggttgaagcgccgcctcgcgaagttctggaagcgctggctaacgaacgc
aatccgctgtacgaagagattgccgacgtcaccattcgcaccgacgatcaaagcgctaag
gttgtggcaaaccagattattcatatgctggaaagcaactaa

DBGET integrated database retrieval system