KEGG   Salmonella enterica subsp. enterica serovar Heidelberg CFSAN002069: CFSAN002069_17645Help
Entry
CFSAN002069_17645 CDS       T02735                                 

Gene name
nlpD
Definition
(GenBank) lipoprotein NlpD
  KO
K06194  lipoprotein NlpD
Organism
senh  Salmonella enterica subsp. enterica serovar Heidelberg CFSAN002069
Brite
KEGG Orthology (KO) [BR:senh00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99992 Structural proteins
    CFSAN002069_17645 (nlpD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M23 LysM Biotin_lipoyl_2
Motif
Other DBs
NCBI-ProteinID: AGQ78984
LinkDB All DBs
Position
complement(3473841..3474974)
Genome map
AA seq 377 aa AA seqDB search
MSAGSPKFTVSRIAALSLVSLWLAGCTSSSNPPAPVTSVDSGSSSNTNSGMLITPPPKMG
ATTQQTPQQAPQIQPVQRPVTQPMQTQPVTEQPVQMENGRIVYNRQYGNIPKGSYTGGST
YTVKKGDTLFYIAWITGNDFRDLAQRNSISAPYSLNVGQTLQVGNASGTPITGGNAITQA
DAAQQGVVTRSAQNSTVAVASQPTITYSEGSGEQSANKMLPNNKPAGTVVTAPVTAPTVS
TTEPNASSTSTSAPISAWRWPTDGKVIENFGASEGGNKGIDIAGSKGQAIVATADGRVVY
AGNALRGYGNLIIIKHNDDYLSAYAHNDTMLVREQQEVKAGQKIATMGSTGTSSTRLHFE
IRYKGKSVNPLRYLPQR
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atgagcgcgggaagcccaaaattcaccgttagtcgcattgcggcactatcactggtttca
ctatggctggcaggttgtaccagttcgtcaaaccctccggcgccggtcacgtctgtggac
agtgggtcgtcatcaaataccaattccgggatgttgatcacaccgccgccaaaaatgggc
gcgacgacgcaacaaacgccgcaacaagcgccgcaaattcaacccgttcagcgtcctgta
acgcagcccatgcaaactcaaccggtcacggaacaacccgtgcagatggaaaatgggcga
atcgtatacaatcgccagtatgggaatattccgaaaggtagctatacgggtggcagtact
tacaccgtgaaaaagggtgatacgcttttttacatcgcctggattaccgggaacgatttc
cgcgatctggcccagagaaacagtatttctgccccgtatagcctgaatgtagggcaaact
ttgcaagttggtaacgcatccggtacgccaattactggcggaaatgcgatcacccaggcg
gatgcagcacagcaaggagttgtgaccaggtctgcacaaaattccaccgttgcagttgcg
tctcaaccaacaattacgtattctgagggctcaggtgaacaaagtgctaacaaaatgttg
ccaaacaacaagcctgctgggacggttgtcacagcgcctgtaacggcaccaacggtaagc
acgaccgaaccaaatgcaagcagtacgtcaaccagcgcgccgatttccgcatggcgctgg
ccgacggatggcaaagtgatcgaaaactttggcgcttccgaagggggcaataaagggatc
gacattgcaggcagtaagggacaggctatcgtcgcaaccgctgatgggcgcgtcgtatat
gccggtaacgcactgcgtggttacggtaatcttattatcatcaaacataacgatgattac
ctgagtgcctacgcccataatgatacgatgctggtccgggaacaacaggaagttaaggcg
gggcaaaaaatcgctactatgggtagcaccggcaccagctctacacgcttgcattttgaa
attcgttacaaggggaaatccgtaaacccgctgcgttatttaccgcagcgataa

DBGET integrated database retrieval system