KEGG   Salmonella enterica subsp. enterica serovar Heidelberg CFSAN002069: CFSAN002069_18310Help
Entry
CFSAN002069_18310 CDS       T02735                                 

Definition
(GenBank) 4-aminobutyrate aminotransferase
  KO
K07250  4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase [EC:2.6.1.19 2.6.1.22]
Organism
senh  Salmonella enterica subsp. enterica serovar Heidelberg CFSAN002069
Pathway
senh00250  Alanine, aspartate and glutamate metabolism
senh00280  Valine, leucine and isoleucine degradation
senh00410  beta-Alanine metabolism
senh00640  Propanoate metabolism
senh00650  Butanoate metabolism
senh01100  Metabolic pathways
senh01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:senh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    CFSAN002069_18310
   00650 Butanoate metabolism
    CFSAN002069_18310
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    CFSAN002069_18310
   00280 Valine, leucine and isoleucine degradation
    CFSAN002069_18310
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CFSAN002069_18310
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:senh01007]
    CFSAN002069_18310
Enzymes [BR:senh01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     CFSAN002069_18310
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     CFSAN002069_18310
Amino acid related enzymes [BR:senh01007]
 Aminotransferase (transaminase)
  Class III
   CFSAN002069_18310
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: AGQ79089
LinkDB All DBs
Position
3348794..3350077
Genome map
AA seq 427 aa AA seqDB search
MNTNNALMQRRHNAVPRGVGQIHPIFAERAENCRVWDVEGREYLDFAGGIAVLNTGHLHP
GIVSAVEAQLKKLSHTCFQVLAYEPYLALCERMNQKVPGDFAKKTLLVTTGSEAVENAVK
IARAATKRSGAIAFSGAYHGRTHYTLSLTGKVHPYSAGMGLMPGHVYRALYPCPLHNISD
DDAIASIERIFKNDAAPEDIAAIIIEPVQGEGGFYAASPAFMQRLRALCDQHGIMLIADE
VQSGAGRTGTLFAMEQMGVAADITTFAKSIAGGFPLAGVTGRADVMDAIAPGGLGGTYAG
NPIACAAALAVLDIFEQENLLQKANTLGKTLRDGLMEIAETHREIGDVRGLGAMIAIELF
ENGDPGKPNAALTADIVTRAREKGLILLSCGPYYNILRILVPLTIEASQIRQGLEIIAQC
FDEAKQA
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgaataccaataacgctttaatgcagcgccgtcataacgccgttcctcgcggcgtgggc
cagattcacccgattttcgccgagcgggcggaaaattgtcgggtctgggatgtcgaaggc
cgtgagtatctcgatttcgcgggcggcattgccgtcctgaacaccggtcatttacatccg
ggcattgtttcagcggtcgaagcgcagttgaagaaattgtcccatacctgttttcaggtg
ctggcctatgaaccgtatctggcgttgtgcgaacgcatgaaccagaaggtaccgggcgat
ttcgccaaaaaaacgttgctggtcacgaccggttcagaagcggttgaaaacgccgtgaaa
atcgcccgcgcggcaacaaaacgcagcggcgctatcgcgtttagcggcgcttaccacggt
cgtacccactacacgctctctctgaccgggaaagtacacccgtactctgctggtatggga
ttgatgccaggccatgtctaccgcgcgctttatccttgcccgctacacaacatcagcgac
gacgacgcgatcgccagcattgaacgcatctttaaaaatgatgccgcgccggaagatatc
gccgccattattattgagccggtacagggcgaaggcggattttacgccgcctctcccgcg
tttatgcagcgactgcgcgcgctatgcgaccaacacggcattatgttgattgccgacgaa
gtgcaaagcggcgcgggccggaccggtacgctgttcgccatggaacagatgggcgttgcg
gcagatattaccacgtttgcgaaatcgatcgccggcggctttccgctggcaggcgttacc
ggccgggcagacgtgatggacgctatcgcgccgggcgggctgggcggcacctatgccgga
aacccgattgcctgcgccgccgcgctggcggtactggacattttcgagcaggaaaatcta
ctgcaaaaggcgaatacgcttggcaaaacgctgcgcgatggcctgatggagatagcggaa
acgcaccgtgagattggtgacgtgcgcggactgggcgccatgatcgccattgagttgttc
gaaaatggcgaccccggcaaaccgaacgcggctctgaccgccgacattgtgacccgcgcc
cgcgagaaagggttaattctgctctcctgcggtccttactacaacatcttgcgcatcctc
gttccactcactattgaggcctcgcagattcggcaaggcctggagattatcgcccagtgc
tttgatgaggcgaaacaagcgtaa

DBGET integrated database retrieval system