KEGG   Salmonella enterica subsp. enterica serovar Typhimurium 138736: CY43_00480Help
Entry
CY43_00480        CDS       T03493                                 

Definition
(GenBank) DNA polymerase II
  KO
K02336  DNA polymerase II [EC:2.7.7.7]
Organism
seni  Salmonella enterica subsp. enterica serovar Typhimurium 138736
Brite
KEGG Orthology (KO) [BR:seni00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:seni03400]
    CY43_00480
Enzymes [BR:seni01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     CY43_00480
DNA repair and recombination proteins [BR:seni03400]
 Prokaryotic Type
  TLS (translesion DNA synthesis) factors
   Other SOS response factors
    CY43_00480
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_pol_B DNA_pol_B_exo1 DNA_pol_B_2 RNase_H_2 P63C
Motif
Other DBs
NCBI-ProteinID: AHX75907
UniProt: A0A0D6HKN2
LinkDB All DBs
Position
complement(113082..115433)
Genome map
AA seq 783 aa AA seqDB search
MAQAGFILTRHWRDTPQGTEVSFWLATDNGPVQATLAPQESVAFIPTSQTSRAASLLQAE
KDYRLTPLQLRDFHRQPVSGLYCRTHRQLMRMEKLLRENGVTVYEADVRPPERYLMERFI
TSPVWVDGEMRNGVIRNARLKPHSDYRPPLKWVSLDIETTRHGELYCIGLEGCGQRTVYM
LGPANGDDHQLDFELVYVASRPQLLEKLNAWFAEHDPDVIIGWNVVQFDLRMLQKHAERY
RIPLRLGRDNSELEWREHGFKNGVFFAQARGRVIIDGIDALKSAFWNFSSFSLEAVSQEL
LGEGKSIDNPWDRMDEIDRRFAQDKPALATYNLKDCELVTRIFHKTEIMPFLLERATING
LPVDRHGGSVAAFGHLYFPRMHRAGYVAPNLGEVPPLASPGGYVMDSQPGLYDSVLVLDY
KSLYPSIIRTFLIDPVGLVEGMAQPDPEHSTEGFLDAWFSREKHCLPEIVSQIWHGRDEA
KRQGNKPLSQALKIIMNAFYGVLGTTACRFFDPRLASSITMRGHAIMRQTKALIEAQGYD
VIYGDTDSTFVWLRRAHSEADAAEIGHRLVRHVNEWWAQTLQQQNLTSALELEFETHFCR
FLMPTIRGADTGSKKRYAGLIQEGDSQRMVFKGLETVRTDWTPLAQRFQQELYLRVFRNE
PYQDYVRETIDKLMAGELDAQLVYRKRLRRPLHEYQRNVPPHVRAARLADEQNLKQGRPA
QYQNRGAIKYVWTVNGPEPVDYQQSPLDYEHYLTRQLQPVAEGILPFVEDNFATLLTGQL
GLF
NT seq 2352 nt NT seq  +upstreamnt  +downstreamnt
gtggcgcaggcaggtttcattttaacccggcactggcgggatacgccgcaagggacggag
gtctctttctggctggcgacagacaacggccctgtgcaggcaacgctggcgccgcaagag
tccgtggcgtttattccgaccagccagacctcccgcgccgcctcgctgctacaggcggaa
aaagactatcgcctgacgccgctccagctgcgagactttcatcgtcagccggtatccggt
ctgtattgccgcactcaccgccagcttatgcggatggagaaactgctgcgcgaaaacggc
gtcaccgtttatgaagcggatgtacgcccgccggaacgttacctgatggagcgttttatt
acgtcgcccgtttgggtagacggcgagatgcgcaacggcgttatccgcaatgcgcgtctt
aaaccccactccgactatcgaccgccgctaaaatgggtctcgctggatatcgaaaccacg
cgacacggcgaactgtattgcattggtctggaaggctgcggccagcgtaccgtttatatg
ctgggcccggcgaatggcgatgaccaccaactggacttcgagcttgtgtatgtcgccagc
cgcccgcagctgctggaaaaactcaacgcctggtttgccgaacatgatcctgatgtcatc
atcggctggaacgtagtgcagttcgacctgcgtatgctgcaaaaacatgccgaacgctac
cgtatccctttacggctggggcgagacaatagcgaactggagtggcgcgaacatggcttc
aaaaacggcgtttttttcgcccaggccagagggcgagtcattatcgatggtatcgacgcg
cttaaatccgcgttctggaatttttcgtctttttcgctggaagccgtctcgcaggaactg
ctcggcgaaggaaaatccattgataacccctgggatcgtatggatgagatcgatcgccgc
tttgcccaggataaacccgccctcgccacctacaacctgaaagactgcgagctggtcacg
cgcattttccataaaaccgagatcatgccgtttttgctggaacgcgcgacgatcaacggc
ctgccggtcgatcgccacggcggttcggtcgccgcattcgggcatctttactttccgcga
atgcaccgcgccggctatgtcgcgcccaatctcggcgaagtgccgccgctggcaagtccc
ggcggctacgtaatggattcacaacccggattatacgattcagtactggtgctggattat
aaaagcctgtacccgtcgattatccgcacgtttttgattgatcccgtcgggctggtcgaa
ggcatggcgcagccggatccggaacacagtaccgaaggtttccttgacgcctggttttca
cgagaaaagcactgcctgccggaaattgttagccaaatctggcacgggcgcgatgaagcc
aaacgtcagggtaataaaccgctctcgcaggcgcttaaaatcattatgaacgccttttat
ggcgtactcggcaccacggcctgtcgctttttcgatccccgtctggcgtcgtcaatcacc
atgcgcggtcatgcgattatgcgccagaccaaagcgctgattgaggcgcagggttatgac
gtgatttatggcgataccgattccactttcgtctggctccggcgcgcgcattcagaagcc
gatgcggcggaaatcgggcacaggctggtgcgtcacgtgaacgaatggtgggcgcagacg
ttacaacagcaaaatttgaccagcgcgctggagctggagtttgaaacccacttttgccgt
tttctgatgccgaccatccgcggcgcggatactggcagtaaaaaacgctacgcgggcctg
attcaggaaggcgacagccagcgcatggtatttaaaggtctggaaacggtgcggaccgac
tggacgccgctggcgcagcgctttcaacaggagctgtatctgcgtgtttttcgcaatgaa
ccttatcaagactatgtgcgcgagactatcgataaactgatggcgggcgaactggacgca
cagctggtttatcgtaagcgtctgcgtcgccctttacatgagtaccaacgtaacgttccg
ccgcacgttcgcgccgcccggctggcggatgaacaaaacctgaagcagggtcgtccggcg
cagtatcagaatcgcggcgccataaaatatgtctggactgttaacggccccgagcccgtg
gattaccagcagtcgccgctggattacgaacactatcttacccgccagctacaacccgtg
gcggaaggaattcttcccttcgttgaagataattttgctacactactgaccgggcaactg
gggttattttga

DBGET integrated database retrieval system