KEGG   Salmonella enterica subsp. enterica serovar Typhimurium 138736: CY43_02195Help
Entry
CY43_02195        CDS       T03493                                 

Definition
(GenBank) beta-lactam-binding protein
  KO
K18988  serine-type D-Ala-D-Ala carboxypeptidase/endopeptidase [EC:3.4.16.4 3.4.21.-]
Organism
seni  Salmonella enterica subsp. enterica serovar Typhimurium 138736
Brite
Enzymes [BR:seni01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     CY43_02195
   3.4.21  Serine endopeptidases
    3.4.21.-  
     CY43_02195
Peptidases and inhibitors [BR:seni01002]
 Serine peptidases
  Family S12: D-Ala-D-Ala carboxypeptidase B family
   CY43_02195
Peptidoglycan biosynthesis and degradation proteins [BR:seni01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   CY43_02195
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta-lactamase Peptidase_S11
Motif
Other DBs
NCBI-ProteinID: AHX76222
UniProt: A0A0D6HAQ7
LinkDB All DBs
Position
complement(466964..468121)
Genome map
AA seq 385 aa AA seqDB search
MKRSLLFTAMLFAASLTSVQAAQPIADPVFASDIVDRYAEHIFYGSGATGMALVVIDGNQ
RVFRSFGDTRPGNNVRPQLDSVIRIASLTKLMTSEMLVKLLDQGTVKLNDPLSKYAPPGA
RVPTYQGTPITLVNLATHTSALPREQPGGAAHRPVFVWPTREQRWNWLSTATLKVAPGSQ
AAYSNLAFDLLADALATASGKPYTQLFEEKITRPLGMKDTTFTPSPDQCKRLMVAEKGAS
PCNNTLAAIGSGGVYSTPGDMMRWMQQYLSSDFYHRSQQADRMQTLIYQRIQLKKIIGMD
VPGKADALGLGWVYMAPKDGRPGIIQKTGGGGGFITYMAMIPQYNIGAFVVVTRSPLTRF
TNMSDGINDLVTELSGNKPIAIPAS
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
ttgaaacgtagtctgctttttactgccatgctgtttgcggcatcacttacttctgtccag
gcggctcagccgattgccgatccggtttttgcctctgatatcgttgatcgttatgccgag
catatcttttatggtagcggcgccacgggcatggcgctggtggtgatcgacggcaatcaa
cgcgtgtttcgtagtttcggtgacaccagaccgggcaataatgttcgtccacagcttgat
tcggtcattcgtatcgcttctctcaccaagctcatgaccagtgaaatgttggtaaaattg
ctcgatcagggaacggtaaaattaaacgatcctctcagcaaatatgcgcctcccggcgcg
cgtgtcccgacgtatcaaggcacgccgattacgttggtcaacttagcgacccacaccagc
gcgcttccgcgagaacagcccggcggcgcggcgcatcgtccggtatttgtctggccaacc
cgcgaacaacgctggaactggctctccacagcaacgttaaaagtcgcgcccggttcacag
gcggcctattccaatctggcgttcgacctgttagccgacgcgctggcgaccgcctccggc
aaaccttatacgcaactgtttgaagaaaagattacccgcccgctgggaatgaaagacacc
acgtttaccccttctcccgatcagtgtaagcgtctgatggtggcagaaaaaggcgcaagc
ccctgtaataatacgctggcagccattggcagcggtggggtctattctacgccaggagat
atgatgcgctggatgcaacagtatctgtcgtcagatttctatcaccgtagccaacaggcc
gatcgtatgcaaacgttgatttatcagcgcatacagttaaagaaaatcatcgggatggac
gtaccgggtaaagccgacgcgctcggtctgggttgggtctatatggcgccaaaagacgga
cgtcctggcattatccagaaaacaggaggcggcggcggttttattacctatatggcgatg
atcccgcaatataatattggcgcttttgtggtggtaacccgttcccccctcactcgtttt
accaatatgagcgacgggattaacgatttggttactgagctaagcggcaataaaccgatt
gctattcctgcatcctga

DBGET integrated database retrieval system