KEGG   Salmonella enterica subsp. enterica serovar Typhimurium 138736: CY43_03470Help
Entry
CY43_03470        CDS       T03493                                 

Definition
(GenBank) D-alanyl-D-alanine carboxypeptidase
  KO
K07258  serine-type D-Ala-D-Ala carboxypeptidase (penicillin-binding protein 5/6) [EC:3.4.16.4]
Organism
seni  Salmonella enterica subsp. enterica serovar Typhimurium 138736
Pathway
seni00550  Peptidoglycan biosynthesis
seni01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:seni00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    CY43_03470
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:seni01002]
    CY43_03470
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:seni01011]
    CY43_03470
Enzymes [BR:seni01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     CY43_03470
Peptidases and inhibitors [BR:seni01002]
 Serine peptidases
  Family S11: D-Ala-D-Ala carboxypeptidase A family
   CY43_03470
Peptidoglycan biosynthesis and degradation proteins [BR:seni01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   CY43_03470
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S11 PBP5_C Beta-lactamase2 Beta-lactamase
Motif
Other DBs
NCBI-ProteinID: AHX76461
UniProt: A0A0D6H2P3
LinkDB All DBs
Position
complement(722248..723459)
Genome map
AA seq 403 aa AA seqDB search
MKTTFSARFMQRMALTTALCAAFISTAHADDLNIKTMIPGVPQIDAESYILIDYNSGKVL
AEQNADERRDPASLTKMMTSYVIGQAMKAGKFKETDLVTVGNDAWATGNPVFKGSSLMFL
KPGMQVPVSQLIRGINLQSGNDACVAMADFAAGSQDAFVGLMNSYVNALGLKNTHFQTVH
GLDADGQYSSARDMALIGQALIRDVPNEYAVYKEKEFTFNGIRQLNRNGLLWDNSLNVDG
IKTGHTSKAGYNLVASATEGQMRLISAVMGGRTYKGRETESKKLLTWGFRFFETVNPLKA
GKEFASEPAWFGNTDRASLGVDKDVYLTIPRGRMKDLKASYVLNTAELHAPLQKNQVVGT
INFQLDGKTIEQRPLVVLQEIPEGNFFGKIIDYIKLMFHHWFG
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgaagaccactttttccgctcgttttatgcagcgcatggcgctcaccacggcgctttgt
gccgcgtttatctcaaccgcacatgccgatgacctgaatatcaaaactatgatcccgggc
gttccgcagatcgatgcggaatcctacatcctgatcgactacaactccggcaaagttctg
gcggaacaaaacgccgacgaacgtcgcgacccggctagtctgacgaagatgatgaccagt
tacgtcatcggacaggcaatgaaagcgggtaaatttaaagaaaccgacctggttaccgtc
ggtaatgacgcctgggccaccggcaatccggtatttaaaggctcctcgctgatgttcctc
aagccgggaatgcaggtaccggtctctcagttgatacgcggcatcaatctgcaatccggc
aatgacgcctgtgtggcgatggctgatttcgccgccggtagccaggatgctttcgtcggg
ctgatgaacagctatgtgaacgcgttggggctgaaaaatacccacttccagaccgtacac
ggcctggacgccgacggacaatacagttcagctcgcgatatggcgctgattggtcaggcg
ttaattcgcgatgtgccgaacgaatatgccgtttataaagaaaaagagttcacctttaac
ggcattcgccagttaaaccgtaacggtctgctgtgggataacagcctgaatgtggacggc
atcaaaaccggccataccagcaaagcgggctataatctggtcgcttccgcaaccgaaggc
cagatgcgattgatttccgccgtgatgggcggacggacctataaaggccgtgaaacagaa
agcaaaaaactgctgacgtggggcttccgtttctttgaaaccgttaatccgctgaaggct
ggtaaagagttcgcctctgaacccgcctggtttggtaataccgatcgcgcctcgctgggc
gtcgataaagacgtttacctgacgatccctcgcggtcgcatgaaagatttgaaagcgagc
tatgtactgaataccgcagaactgcacgcgccgctgcagaaaaaccaggtggtcggcacc
atcaacttccagctggacggtaaaaccatcgagcagcgtccgctggtcgtactgcaagag
atcccggaagggaacttcttcggtaaaatcattgattacattaaattaatgttccatcac
tggtttggataa

DBGET integrated database retrieval system