KEGG   Salmonella enterica subsp. enterica serovar Typhimurium 138736: CY43_06315Help
Entry
CY43_06315        CDS       T03493                                 

Definition
(GenBank) isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
seni  Salmonella enterica subsp. enterica serovar Typhimurium 138736
Pathway
seni00020  Citrate cycle (TCA cycle)
seni00480  Glutathione metabolism
seni01100  Metabolic pathways
seni01110  Biosynthesis of secondary metabolites
seni01120  Microbial metabolism in diverse environments
seni01130  Biosynthesis of antibiotics
seni01200  Carbon metabolism
seni01210  2-Oxocarboxylic acid metabolism
seni01230  Biosynthesis of amino acids
Module
seni_M00009  Citrate cycle (TCA cycle, Krebs cycle)
seni_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:seni00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CY43_06315
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    CY43_06315
Enzymes [BR:seni01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     CY43_06315
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh tRNA_synt_1c_R1
Motif
Other DBs
NCBI-ProteinID: AHX76983
UniProt: A0A0D6GHH5
LinkDB All DBs
Position
1305153..1306403
Genome map
AA seq 416 aa AA seqDB search
MESKVVVPVEGKKITLQNGKLNVPENPIIPFIEGDGIGVDVTPAMLKVVDAAVEKAYKGE
RKISWMEIYTGEKSTQVYGQDVWLPAETLDLIRDYRVAIKGPLTTPVGGGIRSLNVALRQ
ELDLYVCLRPVRYYQGTPSPVKHPELTDMVIFRENSEDIYAGIEWKADSADAEKVIKFLR
EEMGVKKIRFPEHCGIGIKPCSEEGTKRLVRAAIEYAITNDRDSVTLVHKGNIMKFTEGA
FKDWGYQLARDEFGGELIDGGPWLKIKNPNTGKEIVVKDVIADAFLQQILLRPAEYDVIA
CMNLNGDYISDALAAQVGGIGIAPGANIGDECALFEATHGTAPKYAGQDKVNPGSIILSA
EMMLRHMQWFEAADLIVKGMEGAIAAKTVTYDFERLMEGAKLLKCSEFGDAIIANM
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
atggaaagcaaagtagttgttccggtggaaggtaagaagatcaccctgcaaaacggcaaa
ctcaacgttcctgagaatccgattatcccgtttattgaaggcgatggtatcggtgttgat
gtcactccagccatgcttaaagtagtcgatgccgccgtcgagaaagcctataaaggcgag
cgtaaaatttcctggatggaaatttacaccggagaaaaatccacacaggtttacggccag
gatgtctggcttcccgctgaaacccttgatttaattcgtgactaccgcgtagcgattaaa
ggtccattgaccacgccggttggcggcggtatccgctctctgaacgttgccctgcgtcag
gagcttgacctgtacgtttgtctgcgtcccgttcgttactatcagggcacgccaagtccg
gtgaaacatccggagctgaccgatatggtcatcttccgtgaaaactctgaagacatctac
gccggaattgaatggaaagctgactctgcagacgctgagaaagtgatcaagttcctgcgc
gaagagatgggcgtgaagaaaattcgcttcccggagcactgcggtatcggtatcaaaccg
tgttctgaagaaggcactaaacgtctggttcgcgcggcgattgaatacgctattaccaac
gatcgcgattccgtcacgctggtacataaaggcaatatcatgaagttcaccgaaggcgcg
tttaaagactggggctaccagttggcgcgcgacgagttcggcggtgagcttattgacggc
ggtccgtggctgaaaattaagaacccgaacacgggtaaagagatcgtggttaaagacgtt
atcgccgatgcgttcctgcaacaaatcctgttgcgtccggcggaatacgacgttatcgcc
tgtatgaacctgaacggtgactatatttccgatgccctggcggctcaggttggcggtatc
ggtattgcaccgggtgcgaatatcggcgacgaatgcgcgttgtttgaagcgactcacggg
actgcgccgaaatatgcgggccaggataaagtcaacccaggctccattattctgtctgcg
gagatgatgctgcgccacatgcagtggttcgaagccgcagacctgattgttaaaggtatg
gaaggcgcgattgccgcgaagaccgtgacctatgactttgaacgcctgatggaaggcgct
aagctgctgaaatgtagtgagtttggtgacgcgattatcgcgaatatgtaa

DBGET integrated database retrieval system