KEGG   Salmonella enterica subsp. enterica serovar Typhimurium 138736: CY43_07855Help
Entry
CY43_07855        CDS       T03493                                 

Definition
(GenBank) alcohol dehydrogenase
Organism
seni  Salmonella enterica subsp. enterica serovar Typhimurium 138736
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C HI0933_like AlaDh_PNT_C TrkA_N Pyr_redox_2 DAO Peptidase_M55 Pyr_redox_3 Pyr_redox ADH_zinc_N_2 FAD_binding_2
Motif
Other DBs
NCBI-ProteinID: AHX77275
UniProt: A0A0D6G4Y8
LinkDB All DBs
Position
complement(1598723..1599748)
Genome map
AA seq 341 aa AA seqDB search
MKVKAVFINKPGEVETRWVDYPHKKENEVLIKVDAAGICGSDIGAFRGTNPLVTYPRIIG
HEVTGIVLQEGAGMPDNIKEGDRVIVDPYIYCGHCYPCSVGRTNCCENLNVIGVHVDGAM
QEVVTHPAHLIHKIPDNVPSEMAPLAEPLTIALHALHRANVKAGEYVAIIGAGAIGLMAA
LSARHYKATPILIDIVEERLRYAQKLGVPYVLNAADDQVIDAIKNITHGTMAQVVIEASG
ANSAIRNTLDLASFAGRISFTGWPKQETSLPTNLITYKELDLRGSRTSAGEFDEALRMLS
TLEINPQDVVSKVVNLDEIPDAVKELDRYPERYLKINAVFH
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtcaaagctgtgttcattaataagcctggtgaagttgaaacccgctgggtggat
tatccccataagaaagaaaatgaagtattaattaaggttgatgctgcaggcatttgcgga
tcggatatcggggcttttcgtggaacgaacccactggttacttacccaagaattattggg
catgaagtgaccggaattgttcttcaggaaggcgccggaatgccggacaatattaaagaa
ggtgaccgcgtaattgttgacccctatatttattgtggtcactgctacccttgctctgtc
ggcagaactaattgttgtgaaaatttaaacgtcattggcgtgcatgtcgatggcgcaatg
caggaggtggttactcatcccgcacatttaattcataaaataccagataatgtgccttct
gaaatggcgccgctggcagaaccgctgaccatcgctctgcacgcgttgcatcgggcaaac
gttaaggccggggaatatgttgccatcatcggcgcgggggccattggtcttatggcggca
ttaagcgcgcgtcattacaaggcaacgcctattctgatcgatattgtggaagaaaggcta
cgctatgcgcaaaagcttggcgttccttatgtgctgaacgccgctgacgatcaggttatc
gacgctattaaaaatatcacccacggcaccatggcgcaggtcgtgatagaagcttccggc
gcaaatagcgctattcgaaatacgcttgatttagcatcgtttgctggtcgtatttcgttt
accggatggccaaaacaggaaacgtcgctgccgacgaacctgatcacctataaagaactg
gatttacgcggttcccgcaccagtgccggtgaatttgatgaggcattacgtatgctgtct
acgctggagattaatccgcaagatgtcgtcagtaaggtcgtcaatcttgatgagatccct
gatgcagttaaagaacttgatcgctatccggagcgctacttaaagattaatgctgttttc
cattga

DBGET integrated database retrieval system