KEGG   Salmonella enterica subsp. enterica serovar Javiana: CFSAN001992_03875
Entry
CFSAN001992_03875 CDS       T02479                                 

Definition
(GenBank) putative zinc-type alcohol dehydrogenase protein
  KO
K08322  L-gulonate 5-dehydrogenase [EC:1.1.1.380]
Organism
senj  Salmonella enterica subsp. enterica serovar Javiana
Pathway
senj00040  Pentose and glucuronate interconversions
senj01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:senj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    CFSAN001992_03875
Enzymes [BR:senj01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.380  L-gulonate 5-dehydrogenase
     CFSAN001992_03875
SSDB
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C HI0933_like AlaDh_PNT_C TrkA_N Pyr_redox_2 Peptidase_M55 Pyr_redox_3 Pyr_redox FAD_binding_2 DAO
Other DBs
NCBI-ProteinID: AGF81095
LinkDB
Position
742312..743337
AA seq 341 aa
MKVKAVFINKPGEVETRWVDYPHKKENEVLIKVDAAGICGSDIGAFRGTNPLVTYPRIIG
HEVTGIVLQEVTGMPDNIKKGDRVIVDPYIYCGHCYPCSVGRTNCCENLNVIGVHVDGAM
QEVVTHPAHLIHKIPDNVPSEMAPLAEPLTIALHALHRANVKAGEYVAIIGAGAIGLMAA
LSARHYKATPILIDIVEERLRYAQKLGVPYVLNAADDQVIDAIKNITHGTMAQVVIEASG
ANSAIRNTLDLASFAGRISFTGWPKQETSLPTNLITYKELDLRGSRTSAGEFDEALRMLS
TLEINPQDVVSKVVNLDEIPDAVKELDRYPERYLKINAVFH
NT seq 1026 nt   +upstreamnt  +downstreamnt
atgaaagtcaaagctgtgttcattaataagcctggtgaagttgaaacccgctgggtggat
tatccccataagaaagaaaatgaagtattaattaaggttgatgctgcaggcatttgcgga
tcggatatcggggcttttcgtggaacgaacccacttgttacttacccaagaattattggg
catgaagtgaccggaattgttcttcaggaagttaccggaatgccggacaatattaaaaaa
ggcgaccgcgtgattgttgacccctatatttattgtggtcactgctacccttgctctgtc
ggcagaactaactgttgtgaaaatttaaacgtcattggcgtgcatgtcgatggcgcaatg
caggaggtggttactcatcccgcacatttaattcataaaataccagataatgtaccttct
gaaatggcgccgctggcagaaccgctgaccatcgctctgcacgcgctgcatcgggcaaac
gttaaggccggggaatatgttgccatcatcggcgcgggggccattggtcttatggcggca
ttaagcgcgcgtcattacaaggcaacgcctattctgatcgatattgtggaagaaaggcta
cgctatgcgcaaaagcttggcgttccctatgtgctgaacgccgctgacgatcaggttatc
gacgctattaaaaatatcacccacggcaccatggcgcaggtcgtgatagaagcctccggc
gcaaatagcgctattcgaaatacgcttgatttagcatcgtttgctggtcgtatttcgttt
accggatggccaaaacaggaaacgtcgctgccgacgaacctgatcacctataaagaactg
gatttacgcggttcccgcaccagtgccggtgaatttgatgaggcattacgtatgctgtct
acgctggagattaatccgcaagatgttgtcagtaaggtcgtcaatcttgatgagatccct
gatgcagttaaagaacttgatcgctatccggagcgctacttaaagattaatgctgttttc
cattga

DBGET integrated database retrieval system