KEGG   Salmonella enterica subsp. enterica serovar Javiana: CFSAN001992_05455
Entry
CFSAN001992_05455 CDS       T02479                                 

Definition
(GenBank) sensor protein PhoQ
  KO
K07637  two-component system, OmpR family, sensor histidine kinase PhoQ [EC:2.7.13.3]
Organism
senj  Salmonella enterica subsp. enterica serovar Javiana
Pathway
senj01503  Cationic antimicrobial peptide (CAMP) resistance
senj02020  Two-component system
Module
senj_M00744  Cationic antimicrobial peptide (CAMP) resistance, protease PgtE
Brite
KEGG Orthology (KO) [BR:senj00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    CFSAN001992_05455
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01503 Cationic antimicrobial peptide (CAMP) resistance
    CFSAN001992_05455
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:senj01001]
    CFSAN001992_05455
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:senj02022]
    CFSAN001992_05455
   01504 Antimicrobial resistance genes [BR:senj01504]
    CFSAN001992_05455
Enzymes [BR:senj01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     CFSAN001992_05455
Protein kinases [BR:senj01001]
 Histidine kinases
  OmpR family
   CFSAN001992_05455
Two-component system [BR:senj02022]
 OmpR family
  PhoQ-PhoP (magnesium transport)
   CFSAN001992_05455
Antimicrobial resistance genes [BR:senj01504]
 Gene sets
  CAMP resistance modules
   Cationic antimicrobial peptide (CAMP) resistance, protease PgtE [MD:M00744]
    CFSAN001992_05455
SSDB
Motif
Pfam: PhoQ_Sensor HATPase_c HATPase_c_5 HAMP HisKA HATPase_c_2 Med10 HAUS-augmin3 eIF3_subunit HATPase_c_3 IL4
Other DBs
NCBI-ProteinID: AGF81411
LinkDB
Structure
PDB: 
4UEY 3CGZ 1YAX 3CGY

Position
1048492..1049955
AA seq 487 aa
MNKFARHFLPLSLRVRFLLATAGVVLVLSLAYGIVALVGYSVSFDKTTFRLLRGESNLFY
TLAKWENNKISVELPENLDMQSPTMTLIYDETGKLLWTQRNIPWLIKSIQPEWLKTNGFH
EIETNVDATSTLLSEDHSAQEKLKEVREDDDDAEMTHSVAVNIYPATARMPQLTIVVVDT
IPIELKRSYMVWSWFVYVLAANLLLVIPLLWIAAWWSLRPIEALAREVRELEDHHREMLN
PETTRELTSLVRNLNQLLKSERERYNKYRTTLTDLTHSLKTPLAVLQSTLRSLRNEKMSV
SKAEPVMLEQISRISQQIGYYLHRASMRGSGVLLSRELHPVAPLLDNLISALNKVYQRKG
VNISMDISPEISFVGEQNDFVEVMGNVLDNACKYCLEFVEISARQTDDHLHIFVEDDGPG
IPHSKRSLVFDRGQRADTLRPGQGVGLAVAREITEQYAGQIIASDSLLGGARMEVVFGRQ
HPTQKEE
NT seq 1464 nt   +upstreamnt  +downstreamnt
atgaataaatttgctcgccattttctgccgctgtcgctgcgggttcgttttttgctggcg
acagccggcgtcgtgctggtgctttctctggcatatggcatagtggcgctggtcggctat
agcgtaagttttgataaaaccacctttcgtctactgcgcggcgaaagcaacctgttttat
accctcgccaaatgggaaaataataaaatcagcgttgagctgcctgaaaatctggacatg
caaagcccgaccatgacgctgatttacgatgaaacgggcaaattattatggacgcagcgc
aacatcccctggctgattaaaagcattcaaccagaatggttaaaaacgaacggcttccat
gaaattgaaaccaacgtagacgctaccagcacgctgttgagcgaggaccattccgcgcag
gaaaaactcaaagaagtacgtgaagatgacgatgatgccgagatgacccactcggtagcg
gtaaatatttatcctgccacggcgcggatgccgcagttaaccatcgtggtggtcgatacc
attccgatagaactaaaacgctcctatatggtgtggagctggttcgtatacgtgctggcc
gccaatttactgttagtcattcctttactgtggatcgccgcctggtggagcttacgccct
atcgaggcgctggcgcgggaagtccgcgagcttgaagatcatcaccgcgaaatgctcaat
ccggagacgacgcgtgagctgaccagccttgtgcgcaaccttaatcaactgctcaaaagc
gagcgtgaacgttataacaaataccgcacgaccctgaccgacctgacgcacagtttaaaa
acgccgctcgcggttttgcagagtacgttacgctctttacgcaacgaaaagatgagcgtc
agcaaagctgaaccggtgatgctggaacagatcagccggatttcccagcagatcggctat
tatctgcatcgcgccagtatgcgcggtagcggcgtattgttaagccgcgaactgcatccc
gtcgcgccgttgttagataacctgatctccgcgctaaataaagtttatcagcgtaaaggg
gtgaatatcagtatggatatttcaccagagatcagttttgtcggcgagcaaaacgacttt
gtcgaagtaatgggcaacgtactggacaacgcttgtaaatattgtctggagtttgtcgag
atttcggctcgccagaccgacgatcatttgcatattttcgtcgaagatgatggcccaggc
attccccacagcaaacgatccctggtgtttgatcgcggtcagcgcgccgataccctacga
ccaggacaaggcgtggggctggctgtcgcgcgcgagattacggaacaatacgccgggcag
atcattgccagcgacagtctgctcggcggcgcccgtatggaggtcgtttttggccgacag
caccccacacagaaagaggaataa

DBGET integrated database retrieval system