KEGG   Salmonella enterica subsp. enterica serovar Javiana: CFSAN001992_14795Help
Entry
CFSAN001992_14795 CDS       T02479                                 

Definition
(GenBank) N-acetylgalactosamine permease IIC component 1
  KO
K17466  D-glucosaminate PTS system EIIC component
Organism
senj  Salmonella enterica subsp. enterica serovar Javiana
Pathway
senj00030  Pentose phosphate pathway
senj01120  Microbial metabolism in diverse environments
senj02060  Phosphotransferase system (PTS)
Brite
KEGG Orthology (KO) [BR:senj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    CFSAN001992_14795
 09130 Environmental Information Processing
  09131 Membrane transport
   02060 Phosphotransferase system (PTS)
    CFSAN001992_14795
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:senj02000]
    CFSAN001992_14795
Transporters [BR:senj02000]
 Phosphotransferase system (PTS)
  Enzyme II [TC:4.A]
   D-Glucosaminate-specific II component
    CFSAN001992_14795
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: EII-Sor
Motif
Other DBs
NCBI-ProteinID: AGF83249
LinkDB All DBs
Position
3050592..3051341
Genome map
AA seq 249 aa AA seqDB search
MDTLLFASLMGLYYWFARLRLGYTFSAMLLQPVVIAVFVGLLLGNMQTAMIIGAGMQLVY
LGVTSTPGGNVPSDPALAACISIPIAVKAGMDPNLAIALAIPFGVIGVFLDQLRRTLNAA
WVHMADKHAETANMAGIMRCAFLYPALLGLVLRFPVVFAANYFGQDVVESFLKLMPHWLT
HSFEIMGGILPALGFAITIMVIGKKSLLPWFIGGFFAVLYLKVDIMAMAIFGTCVAFLIK
GLAKNEGAA
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atggataccttactctttgcaagcctgatggggttgtattactggtttgcccgtttacgc
ctcggctacaccttctccgcgatgctgttacaaccggtggtgatcgcggtatttgtcggg
cttttgcttggcaatatgcagaccgcgatgattatcggcgcagggatgcagctcgtttat
ttgggcgtgacctcaacgccgggcggcaacgtgccgtcggacccggcgctggcggcctgt
atctccattcctatcgcggtgaaggccggtatggacccaaacctggcgatcgcgctggca
atcccgtttggcgtgattggcgtgtttctcgatcagcttaggcgcacgctgaacgccgcc
tgggtgcatatggcggataaacacgcggaaacggcaaacatggcgggcatcatgcgttgc
gcctttctttacccggcattgctggggttggtactgcgcttcccggtggtctttgccgct
aactactttggccaggatgtggtggaaagtttccttaaactgatgccgcactggttaacc
cactcctttgaaatcatgggcggcattctgccggcgctgggctttgccatcaccattatg
gtgatcggtaaaaagagcctgttgccgtggtttatcggcgggttcttcgcggtgttgtac
ctcaaggtcgacatcatggcgatggccatcttcggcacctgtgtcgccttcctgattaaa
ggcctggcgaaaaatgaaggagcagcatga

DBGET integrated database retrieval system