KEGG   Salmonella enterica subsp. enterica serovar Enteritidis OLF-SE1-1019-1: IY59_01185Help
Entry
IY59_01185        CDS       T03817                                 

Definition
(GenBank) hydroxymyristoyl-ACP dehydratase
  KO
K02372  3-hydroxyacyl-[acyl-carrier-protein] dehydratase [EC:4.2.1.59]
Organism
senl  Salmonella enterica subsp. enterica serovar Enteritidis OLF-SE1-1019-1
Pathway
senl00061  Fatty acid biosynthesis
senl00780  Biotin metabolism
senl01100  Metabolic pathways
senl01212  Fatty acid metabolism
Module
senl_M00083  Fatty acid biosynthesis, elongation
senl_M00572  Pimeloyl-ACP biosynthesis, BioC-BioH pathway, malonyl-ACP => pimeloyl-ACP
Brite
KEGG Orthology (KO) [BR:senl00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    IY59_01185
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    IY59_01185
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:senl01004]
    IY59_01185
Enzymes [BR:senl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     IY59_01185
Lipid biosynthesis proteins [BR:senl01004]
 Fatty acid synthase
  Component type
   IY59_01185
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA MaoC_dehydratas 4HBT PS-DH
Motif
Other DBs
NCBI-ProteinID: AIN03986
UniProt: A0A372N168
LinkDB All DBs
Position
271551..272006
Genome map
AA seq 151 aa AA seqDB search
MTTNTHTLQIEEILELLPHRFPFLLVDRVLDFEDGRFLRAVKNVSVNEPFFQGHFPGKPI
LPGVLILEAMAQATGILAFKSVGKLEPGELYYFAGIDEARFKRPVVPGDQMIMEVTFEKT
RRGLTRFKGVALVDGKVVCEATMMCARSREA
NT seq 456 nt NT seq  +upstreamnt  +downstreamnt
ttgactactaacactcatactctgcagattgaagagattttagagcttctgccgcaccgt
tttccgtttttactggtcgatcgcgtgctggactttgaagacggtcgttttctgcgtgcg
gtgaaaaatgtctccgtcaacgagccgtttttccaggggcactttccgggcaaaccgatt
ttgccaggcgtgctgattctggaagcgatggcgcaggcaaccggtattctggcgtttaaa
agcgttggtaaactggaacctggcgaactgtattatttcgcgggtattgatgaagcgcgc
tttaagcgtccggtggtgccaggcgatcagatgatcatggaagtcactttcgagaaaacg
cgccgtggcctgacccgctttaaaggggttgcgctggtcgacggtaaagtcgtgtgcgaa
gcaaccatgatgtgtgctcgtagccgggaggcctga

DBGET integrated database retrieval system