KEGG   Salmonella enterica subsp. enterica serovar Enteritidis OLF-SE1-1019-1: IY59_01895Help
Entry
IY59_01895        CDS       T03817                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
senl  Salmonella enterica subsp. enterica serovar Enteritidis OLF-SE1-1019-1
Pathway
senl00473  D-Alanine metabolism
senl00550  Peptidoglycan biosynthesis
senl01100  Metabolic pathways
senl01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:senl00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    IY59_01895
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    IY59_01895
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    IY59_01895
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:senl01011]
    IY59_01895
Enzymes [BR:senl01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     IY59_01895
Peptidoglycan biosynthesis and degradation proteins [BR:senl01011]
 Precursor biosynthesis
  Amino acid ligase
   IY59_01895
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2 ATP-grasp_3 ATPgrasp_ST ATP-grasp_4 RimK GARS_A
Motif
Other DBs
NCBI-ProteinID: AIN04114
UniProt: A0A2R4HUI9
LinkDB All DBs
Structure
PDB: 

Position
complement(412983..414077)
Genome map
AA seq 364 aa AA seqDB search
MAKLRVGIVFGGKSAEHEVSLQSAKNIVDAIDKTRFDVVLLGIDKAGQWHVNDAENYLQN
ADDPAHIALRPSAISLAQVPGKHQHQLINAQNGQPLPTVDVIFPIVHGTLGEDGSLQGML
RVANLPFVGSDVLSSAACMDKDIAKRLLRDAGLNIAPFITLTRTNRHAFSFAEVESRLGL
PLFVKPANQGSSVGVSKVANEAQYQQAVALAFEFDHKVVVEQGIKGREIECAVLGNDNPQ
ASTCGEIVLNSEFYAYDTKYIDDNGAQVVVPAQLPSGVNDKIRAIAIQAYQTLGCAGMAR
VDVFLTADNEVVINEINTLPGFTNISMYPKLWQASGLGYTDLISRLIELALERHTANNAL
KTTM
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atggcgaaattgcgggtaggaatagtatttggcggtaagtcggcggaacatgaagtgtct
ttgcaatcagcgaaaaatatcgttgatgcgatcgataaaacccgcttcgacgtggtgctg
ttagggatagataaggcgggacaatggcatgttaacgatgcggaaaattatttgcagaat
gcagacgatccggcacatatcgcgctacgtccttcggcaatcagtctggcccaggtgcct
ggcaaacatcaacaccaattgattaacgcccagaacgggcagccgctaccgacggtagat
gttatttttcctatcgtccacggtacgctgggcgaagacggctcattgcaggggatgctg
cgcgtcgcaaacttaccgtttgtcggttcagacgtgctgagctccgcagcctgcatggat
aaagacatcgccaaacgactgctacgcgatgcaggactgaatatcgccccgtttattaca
ctcacccgaacgaatcgtcacgcgtttagttttgccgaggttgaatcccgtctgggactg
ccgctgttcgttaagcccgccaatcagggctcttcggtcggcgttagtaaagtcgctaac
gaagcgcaatatcagcaggcggtcgcgctggctttcgaattcgatcataaagtggtggtg
gagcaagggatcaaagggcgcgagatcgaatgcgccgtattaggtaacgataacccacag
gccagtacctgcggcgaaatcgtactgaacagcgaattttacgcctacgatactaagtat
attgatgataatggcgcacaagttgtcgtgcctgcgcagcttccttccggggtgaatgac
aagatccgcgcgatcgcgatccaggcttatcagacgctgggatgcgcgggtatggcgcgt
gtcgatgtcttcttaacggcagacaatgaggtcgtgattaacgagattaatacgctgcca
ggttttaccaatatcagtatgtatccaaaactctggcaggcgagcggattgggctatacc
gatttgatcagccgcctgattgagctggcgctggaacgccatacggcgaataacgcctta
aaaaccacgatgtaa

DBGET integrated database retrieval system