KEGG   Salmonella enterica subsp. enterica serovar Enteritidis OLF-SE1-1019-1: IY59_03010Help
Entry
IY59_03010        CDS       T03817                                 

Definition
(GenBank) alkyl hydroperoxide reductase
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
senl  Salmonella enterica subsp. enterica serovar Enteritidis OLF-SE1-1019-1
Brite
KEGG Orthology (KO) [BR:senl00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    IY59_03010
Enzymes [BR:senl01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     IY59_03010
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 HI0933_like FAD_oxidored NAD_binding_8 FAD_binding_3 Thi4 Glutaredoxin K_oxygenase AlaDh_PNT_C FMO-like DAO
Motif
Other DBs
NCBI-ProteinID: AIN04331
UniProt: A0A1R2XU09
LinkDB All DBs
Structure
PDB: 

Position
643167..644732
Genome map
AA seq 521 aa AA seqDB search
MLDTNMKTQLRAYLEKLTKPVELIATLDDSAKSAEIKELLAEIAELSDKVTFKEDNTLPV
RKPSFLITNPGSQQGPRFAGSPLGHEFTSLVLALLWTGGHPSKEAQSLLEQIRDIDGDFE
FETYYSLSCHNCPDVVQALNLMAVLNPRIKHTAIDGGTFQNEITERNVMGVPAVFVNGKE
FGQGRMTLTEIVAKVDTGAEKRAAEALNKRDAYDVLIVGSGPAGAAAAVYSARKGIRTGL
MGERFGGQVLDTVDIENYISVPKTEGQKLAGALKAHVSDYDVDVIDSQSASKLVPAAAEG
GLHQIETASGAVLKARSIIIATGAKWRNMNVPGEDQYRTKGVTYCPHCDGPLFKGKRVAV
IGGGNSGVEAAIDLAGIVEHVTLLEFAPEMKADQVLQDKVRSLKNVDIILNAQTTEVKGD
GSKVVGLEYRDRVSGDIHSVALAGIFVQIGLLPNTHWLEGALERNRMGEIIIDAKCETSV
KGVFAAGDCTTVPYKQIIIATGEGAKASLSAFDYLIRTKIA
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atgctcgacacaaatatgaaaacccagctcagggcttaccttgagaaactgaccaaacct
gttgagctgattgccacgctggatgacagcgctaaatcggcggaaatcaaggaactgctg
gctgaaatcgccgagctgtccgacaaagtcacgtttaaagaagacaatactctgccggtg
cgcaagccgtctttcctgattacgaatccaggttctcagcaagggccgcgctttgccggt
tctccgctgggccacgaatttacctcgctggttttggcgctgctgtggaccggcggtcat
ccgtcaaaagaagcgcagtcgctgctggagcagattcgcgatattgacggcgattttgaa
ttcgaaacttattattcactctcctgccataactgcccggacgtagtgcaggcgctgaac
ctgatggcggtgctgaacccgcgtattaaacatacggcaattgatggcggcaccttccag
aacgaaatcaccgaacgtaacgtgatgggcgttccggcggtgtttgtcaacggtaaagag
ttcggccagggacgtatgactctgaccgagattgtcgctaaagtggatactggcgcagaa
aaacgtgcggcggaagcgctgaacaaacgcgatgcgtatgacgtgctgattgtcggctcc
ggcccggcgggcgcggcggcggcggtctactcggcgcgcaaaggcatccgtaccggtctg
atgggcgagcgcttcggcggtcaggtgctggataccgtggatatcgaaaactatatctcg
gtgccgaaaaccgaaggccagaaactggcgggcgcgctgaaagcgcatgtcagcgattac
gacgttgacgttatcgacagccagagcgcaagtaaactggttccggcagcggcagaaggc
ggcctgcatcagattgaaacggcgtccggcgcagtcttgaaagcgcgcagtatcatcatc
gccaccggcgcgaaatggcgcaatatgaatgtgccgggcgaggatcagtatcgcaccaaa
ggcgtcacctattgtccgcactgcgacggtccgttatttaaagggaagcgtgtggcggtc
atcggcggcggcaactctggcgttgaagcggctatcgatctggcaggtattgtagaacac
gttacgttgctggagttcgcgccggagatgaaggcggatcaggtgctacaggacaaagtg
cgtagcctgaaaaatgtcgatatcattttgaatgcgcaaacgacagaagtgaagggcgac
ggttcgaaagtggtggggctggagtatcgtgaccgtgtcagcggcgatattcatagcgtc
gcgctggcagggatttttgtgcagattggtctgttgccgaatacccactggctggaaggc
gcgcttgagcgtaaccgcatgggcgagatcattattgacgccaaatgtgaaaccagcgtt
aagggcgtcttcgctgcaggcgattgcaccaccgttccttacaaacagattatcatcgcc
acaggcgaaggggcgaaagcctcgttgagcgcctttgattatctgattcgtaccaaaatc
gcataa

DBGET integrated database retrieval system