KEGG   Salmonella enterica subsp. enterica serovar Enteritidis OLF-SE1-1019-1: IY59_03785Help
Entry
IY59_03785        CDS       T03817                                 

Gene name
gpmA
Definition
(GenBank) phosphoglyceromutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
senl  Salmonella enterica subsp. enterica serovar Enteritidis OLF-SE1-1019-1
Pathway
senl00010  Glycolysis / Gluconeogenesis
senl00260  Glycine, serine and threonine metabolism
senl00680  Methane metabolism
senl01100  Metabolic pathways
senl01110  Biosynthesis of secondary metabolites
senl01120  Microbial metabolism in diverse environments
senl01130  Biosynthesis of antibiotics
senl01200  Carbon metabolism
senl01230  Biosynthesis of amino acids
Module
senl_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
senl_M00002  Glycolysis, core module involving three-carbon compounds
senl_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:senl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    IY59_03785 (gpmA)
  09102 Energy metabolism
   00680 Methane metabolism
    IY59_03785 (gpmA)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    IY59_03785 (gpmA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:senl04131]
    IY59_03785 (gpmA)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:senl04147]
    IY59_03785 (gpmA)
Enzymes [BR:senl01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     IY59_03785 (gpmA)
Membrane trafficking [BR:senl04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    IY59_03785 (gpmA)
Exosome [BR:senl04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   IY59_03785 (gpmA)
  Exosomal proteins of melanoma cells
   IY59_03785 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: AIN04472
UniProt: A0A1R2LRN6
LinkDB All DBs
Position
complement(795751..796503)
Genome map
AA seq 250 aa AA seqDB search
MAVTKLVLVRHGESQWNKENRFTGWYDVDLSEKGVSEAKAAGKLLKEEGFSFDFAYTSVL
KRAIHTLWNVLDELDQAWLPVEKSWKLNERHYGALQGLNKAETAEKYGDEQVKQWRRGFA
VTPPELTKDDERYPGHDPRYAKLSEKELPLTESLALTIDRVIPYWNDTILPRMKSGERVI
IAAHGNSLRALVKYLDNMSEDEILELNIPTGVPLVYEFDENFKPLKHYYLGNADEIAAKA
AAVANQGKAK
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atggctgtaactaagctggttctggtacgtcacggtgaaagtcaatggaacaaagagaac
cgtttcaccggctggtatgatgttgacctgtctgaaaaaggcgtaagcgaagcaaaagca
gcgggtaaactgctaaaagaagaaggtttcagctttgattttgcctacacttccgtactg
aaacgcgctatccatacgctgtggaacgtactggatgaactggatcaagcgtggctgccg
gtggaaaaatcctggaaactcaatgaacgtcactatggcgcgttgcaggggctgaataaa
gcggaaacggcagaaaaatatggtgacgagcaggttaaacagtggcgccgcggttttgcc
gtgacgccgccggaactgaccaaagatgatgagcgttatccgggtcacgatccacgttat
gccaaactgagcgagaaagagctgccgttgaccgaaagtctggcgctgaccatcgaccgc
gttattccttactggaacgacaccatcctgccgcgtatgaagagcggtgagcgcgtgatc
atcgccgctcacggtaactcattgcgtgcgctggtgaaatacctggataacatgagtgaa
gatgagatccttgagttaaacatcccgaccggcgtgccgctggtgtatgagttcgacgaa
aacttcaagccgctcaaacattactatctgggcaacgctgacgaaatcgccgcgaaagcg
gctgccgtggcgaatcagggtaaagcgaagtaa

DBGET integrated database retrieval system