KEGG   Salmonella enterica subsp. enterica serovar Enteritidis OLF-SE1-1019-1: IY59_07040Help
Entry
IY59_07040        CDS       T03817                                 

Definition
(GenBank) enoyl-ACP reductase
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
senl  Salmonella enterica subsp. enterica serovar Enteritidis OLF-SE1-1019-1
Pathway
senl00061  Fatty acid biosynthesis
senl00780  Biotin metabolism
senl01100  Metabolic pathways
senl01130  Biosynthesis of antibiotics
senl01212  Fatty acid metabolism
Module
senl_M00083  Fatty acid biosynthesis, elongation
senl_M00572  Pimeloyl-ACP biosynthesis, BioC-BioH pathway, malonyl-ACP => pimeloyl-ACP
Brite
KEGG Orthology (KO) [BR:senl00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    IY59_07040
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    IY59_07040
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    IY59_07040
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:senl01004]
    IY59_07040
Enzymes [BR:senl01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     IY59_07040
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     IY59_07040
Lipid biosynthesis proteins [BR:senl01004]
 Fatty acid synthase
  Component type
   IY59_07040
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR
Motif
Other DBs
NCBI-ProteinID: AIN05086
UniProt: A0A1R3AL25
LinkDB All DBs
Position
complement(1423534..1424322)
Genome map
AA seq 262 aa AA seqDB search
MGFLSGKRILVTGVASKLSIAYGIAQAMHREGAELAFTYQNDKLKGRVEEFAAQLGSSIV
LPCDVAEDASIDAMFAELGNVWPKFDGFVHSIGFAPGDQLDGDYVNAVTREGFKIAHDIS
SYSFVAMAKACRTMLNPGSALLTLSYLGAERAIPNYNVMGLAKASLEANVRYMANAMGPE
GVRVNAISAGPIRTLAASGIKDFRKMLAHCEAVTPIRRTVTIEDVGNSAAFLCSDLSAGI
SGEVVHVDGGFSIAAMNELELK
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgggttttctttccggtaagcgcattctggtcactggcgtggccagtaaactgtccatc
gcctacggtatcgcacaggcgatgcaccgcgaaggagctgaactggcgttcacctaccag
aacgacaaactgaaaggccgcgtagaagaatttgctgcccagctgggttccagcatcgtt
ttaccgtgtgatgtcgctgaagatgccagcattgacgctatgtttgcggagctgggtaac
gtttggccgaaatttgacggttttgtacactcgatcggtttcgcgcctggcgatcagctg
gacggcgattatgttaatgcggttacccgcgaaggctttaaaatcgctcacgatattagc
tcttacagctttgttgccatggcgaaagcctgccgcaccatgctgaatccgggttctgcg
ctgttgaccttgtcttatctgggagcggagcgcgccatcccgaactacaatgtcatgggt
ctggcgaaagcctctctggaagccaacgtgcgttatatggcaaatgcaatggggccggaa
ggcgttcgcgtcaacgccatctctgcgggtccaatccgcacgctggcggcgtccggtatt
aaagacttccgtaaaatgctggcgcattgtgaagccgttacgccaattcgtcgcaccgtg
accattgaagatgtgggtaactcagcggcgtttctgtgttccgatctctcggcaggcatt
tctggcgaagtcgtccatgttgacggcgggttcagcattgcggcaatgaatgaactggaa
ctgaagtaa

DBGET integrated database retrieval system