KEGG   Salmonella enterica subsp. enterica serovar Enteritidis OLF-SE1-1019-1: IY59_10690Help
Entry
IY59_10690        CDS       T03817                                 

Definition
(GenBank) D-alanyl-D-alanine carboxypeptidase
  KO
K07258  serine-type D-Ala-D-Ala carboxypeptidase (penicillin-binding protein 5/6) [EC:3.4.16.4]
Organism
senl  Salmonella enterica subsp. enterica serovar Enteritidis OLF-SE1-1019-1
Pathway
senl00550  Peptidoglycan biosynthesis
senl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:senl00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    IY59_10690
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:senl01002]
    IY59_10690
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:senl01011]
    IY59_10690
Enzymes [BR:senl01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     IY59_10690
Peptidases [BR:senl01002]
 Serine Peptidases
  Family S11: D-Ala-D-Ala carboxypeptidase A family
   IY59_10690
Peptidoglycan biosynthesis and degradation proteins [BR:senl01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   IY59_10690
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S11 PBP5_C Beta-lactamase2 Beta-lactamase CDPS
Motif
Other DBs
NCBI-ProteinID: AIN05774
UniProt: A0A2R4HPS3
LinkDB All DBs
Position
complement(2098618..2099790)
Genome map
AA seq 390 aa AA seqDB search
MLLKRRLFIAASLFAMHLSPALAADAVSFAPQPPAIDAGAWVLMDYTTGQVLTAGNEHQQ
RNPASLTKLMTGYVVDRAIDSHRISPDDIVTVGRDAWAKDNPVFVGSSLMFLKEGDRVSV
RDLSRGLIVDSGNDACVALADYIAGGQPQFVAMMNSYVKKLNLQDTHFETVHGLDAPGQH
SSAYDLAVLSRAIIHGEPEFYHMYSEKSLTWNGITQQNRNGLLWDKTMHIDGLKTGHTSG
AGFNLIASAVDGQRRLIAVVMGAKSSKGREEQARKLLQWGQQNFATVQILHSGKKVGSER
IWYGDKEKIALGTEQDFWMALPKAEIPHIKAKYVLDRKELEAPIAAHQRVGEIELYDRDK
LIAQWPLVTLESVGKGGMFSRLSDYFQHKA
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atgctgttgaaacgccgtttgtttattgccgcttctttattcgcgatgcacctttctcct
gcgcttgcggccgatgccgtaagttttgctccccaaccgccagccattgatgcaggcgcc
tgggtgttgatggattacactacggggcaggttcttaccgccggtaatgaacaccagcaa
cgtaatcccgccagccttaccaagctaatgacgggctacgtcgtcgatcgcgccatcgat
agtcatcgtatcagccctgacgatatcgtcacagttgggcgcgacgcctgggcgaaggat
aatccggtgtttgtcggctcctcgttgatgtttttaaaagaaggggatcgcgtgtcggta
cgcgatttaagccgtggcttaattgtggattccggtaacgatgcctgtgtggcgctggcg
gattatatcgcgggcgggcagccgcagtttgtggcgatgatgaacagctatgtgaaaaaa
ctcaatttgcaggatacccattttgaaaccgtccacggtctggatgcgccgggacaacat
agctccgcgtatgatctggccgtactctcccgggcgattattcacggcgaacctgaattt
tatcacatgtacagcgagaaaagcctgacctggaacggcatcacgcagcagaaccgcaac
ggcttgttgtgggataagaccatgcatatcgatgggcttaaaaccggacacacatcgggg
gcgggatttaatcttatcgcatcggcggtggacgggcagcgtcgacttatcgccgtcgtg
atgggggcgaaaagttcgaaaggccgtgaggaacaggcgcgaaaactgttgcagtggggc
cagcaaaactttgcgacggtgcagattttgcacagcggtaaaaaagtgggcagcgagcga
atctggtatggagataaagaaaagattgcgctgggtacggaacaggatttctggatggcg
ctgcctaaagcggaaattccgcatatcaaagcaaaatatgtgctggatagaaaagagctg
gaggcgccaatcgccgctcatcaacgggtaggtgaaatagagctatacgatcgggataaa
ctgatcgctcagtggccgctggtcactctggagtcggtgggtaaaggcggtatgttctct
cgtctgagcgactattttcagcataaagcgtaa

DBGET integrated database retrieval system