KEGG   Salmonella enterica subsp. enterica serovar Enteritidis OLF-SE1-1019-1: IY59_15315Help
Entry
IY59_15315        CDS       T03817                                 

Definition
(GenBank) 6-phospho-beta-glucosidase
  KO
K01223  6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
senl  Salmonella enterica subsp. enterica serovar Enteritidis OLF-SE1-1019-1
Pathway
senl00010  Glycolysis / Gluconeogenesis
senl00500  Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:senl00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    IY59_15315
   00500 Starch and sucrose metabolism
    IY59_15315
Enzymes [BR:senl01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     IY59_15315
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_1 Cellulase
Motif
Other DBs
NCBI-ProteinID: AIN06661
UniProt: A0A2D3AG33
LinkDB All DBs
Position
3090672..3092105
Genome map
AA seq 477 aa AA seqDB search
MRKLTLPKDFLWGGAVAAHQVEGGWNKDGKGPSICDVLTGGAHGVPREITQNVVAGKYYP
NHEAVDFYGHYKEDIRLFAEMGFKCFRTSIAWTRIFPNGDESQPNEAGLKFYDDMFDELL
KYNIEPVITLSHFEMPLHLVQHYGGWTNRKVVDFFVRFAEVVFERYKHKVKYWMTFNEIN
NQRNWRAPLFGYCCSGVVYTEHENPEETMYQVLHHQFVASALAVKAARRINPQMKVGCML
AMVALYPFSCKPEDVMFAQESMRERYVFTDVQLRGYYPSYVLNEWERRGFNIKMEDGDLE
VLREGTCDYLGFSYYMTNAVKAEGGSGDAISGFEGSVPNPYVKASDWGWQIDPVGLRYSL
CELYERYQKPLFIVENGFGAYDKVEEDGSINDDYRIDYLRAHIEEMKKAVTYDGVDLMGY
TPWGCIDCVSFTTGQYSKRYGFIYVNKHDDGTGDMSRSRKKSFNWYKEVIASNGEKL
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaactcaccttgccaaaagattttttatggggcggcgcggttgctgcacaccag
gttgaaggcggctggaataaagacggtaaaggccccagcatctgcgacgtgctaaccggc
ggcgcacacggcgtgccacgcgaaatcacccagaatgtcgttgctggcaaatactatccg
aaccacgaggcggtggatttttacggacattacaaagaagacatccgtcttttcgccgaa
atggggttcaaatgcttccgtacctctattgcctggacgcgtatcttcccgaatggcgac
gaatcccagccaaacgaggccggtctgaaattctacgacgacatgtttgatgagttactc
aaatacaacatcgaaccggtcatcaccctttcccactttgaaatgccattacatctggta
cagcactacggcggctggaccaatcgtaaggtcgttgatttctttgtccgttttgctgaa
gtcgtgtttgaacgctacaaacataaggtcaaatactggatgaccttcaacgaaattaac
aaccagcgaaactggcgcgcgccgctgtttggctactgctgttccggcgtggtgtatacc
gagcatgagaatccagaagaaaccatgtatcaggtcttacatcatcagtttgtcgccagc
gcgctggcggtaaaagcggcacgtcgcattaacccgcagatgaaagtgggttgtatgctg
gcgatggtcgcgctgtatcctttctcctgtaaaccagaagatgtgatgtttgctcaggag
tcgatgcgtgaacgctacgtctttaccgatgtgcagctgcgcggctattacccgtcctat
gtgttgaacgagtgggagcgccgcggatttaacatcaaaatggaagatggcgatcttgaa
gtgctgcgcgaaggcacctgcgattatcttggtttcagttattacatgaccaacgcggtc
aaagccgaaggcggtagcggcgatgcgatttccggttttgaaggcagcgtaccgaacccc
tatgttaaagcatctgactggggctggcagattgatccggtgggcctgcgttattcattg
tgtgaactgtacgaacgctatcaaaagccgctgtttattgtcgaaaacggttttggtgct
tacgacaaagtagaagaagatggcagcatcaacgacgactaccgaattgactacctgcgc
gcccatattgaagagatgaaaaaagcggtgacttacgatggtgtcgacctgatgggctac
acgccgtggggctgcatcgactgcgtgtcgttcaccaccggtcagtacagcaagcgctac
ggcttcatctacgtgaacaagcacgatgacggtacgggcgatatgtcgcgttcgcgtaag
aagagcttcaactggtacaaagaggtgattgccagcaacggcgagaagctttaa

DBGET integrated database retrieval system