KEGG   Salmonella enterica subsp. enterica serovar Enteritidis OLF-SE1-1019-1: IY59_20370Help
Entry
IY59_20370        CDS       T03817                                 

Definition
(GenBank) superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
senl  Salmonella enterica subsp. enterica serovar Enteritidis OLF-SE1-1019-1
Brite
Enzymes [BR:senl01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     IY59_20370
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: AIN07616
UniProt: A0A1R3CN09
LinkDB All DBs
Position
4127492..4128112
Genome map
AA seq 206 aa AA seqDB search
MSYTLPSLPYAYDALEPHFDKQTMEIHHTKHHQTYVNNANAALENLPEFADLPVEELITK
LDQVPADKKTVLRNNAGGHANHSFFWKGLKKGTTLQGDLKAAIERDFGSVDNFKAEFEKA
AATRFGSGWAWLVLKGDKLAVVSTANQDSPLMGEAISGASGFPILGLDVWEHAYYLKFQN
RRPDYIKEFWNVVNWDEAAARFAAKK
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atgagttatacactgccatccctgccgtacgcttatgatgcactggaaccgcacttcgat
aagcagacgatggagattcaccacaccaaacaccatcaaacctatgtcaacaacgctaac
gcggcgctggaaaacttgccagagtttgctgacctgccggttgaagaactgattactaaa
ctggaccaggtgccagcggacaaaaaaaccgtgctgcgtaataacgcgggcggccacgct
aaccacagcttcttctggaaaggcctgaaaaaaggcaccaccctgcagggcgatctgaaa
gcggctatcgagcgtgacttcggttccgttgacaacttcaaagctgaattcgaaaaagca
gcagcaacccgtttcggctccggctgggcgtggctggtgctgaaaggcgacaaactggct
gtggtttctaccgcaaaccaggattccccgctgatgggtgaagccatttccggcgcttcc
ggcttcccgatcctgggtctggacgtgtgggaacacgcttactacctgaaattccagaac
cgccgcccggactacatcaaagagttctggaacgtggtgaactgggacgaagcagcagcg
cgtttcgccgctaaaaaataa

DBGET integrated database retrieval system