KEGG   Salmonella enterica subsp. enterica serovar Newport USMARC-S3124.1: SN31241_13770Help
Entry
SN31241_13770     CDS       T02779                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
senn  Salmonella enterica subsp. enterica serovar Newport USMARC-S3124.1
Pathway
senn00473  D-Alanine metabolism
senn00550  Peptidoglycan biosynthesis
senn01100  Metabolic pathways
senn01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:senn00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    SN31241_13770
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    SN31241_13770
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    SN31241_13770
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:senn01011]
    SN31241_13770
Enzymes [BR:senn01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     SN31241_13770
Peptidoglycan biosynthesis and degradation proteins [BR:senn01011]
 Precursor biosynthesis
  Amino acid ligase
   SN31241_13770
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2 ATP-grasp_4 ATP-grasp_3 ATPgrasp_ST RimK GARS_A
Motif
Other DBs
NCBI-ProteinID: AGS28350
LinkDB All DBs
Structure
PDB: 

Position
complement(1424539..1425651)
Genome map
AA seq 370 aa AA seqDB search
MEWVFKMAKLRVGIVFGGKSAEHEVSLQSAKNIVDAIDKTRFDVVLLGIDKAGQWHVNDA
ENYLQNADDPAHIALRPSAISLAQVPGKHQHQLINAQNGQPLPTVDVIFPIVHGTLGEDG
SLQGMLRVANLPFVGSDVLSSAACMDKDVAKRLLRDAGLNIAPFITLTRTNRHAFSFAEV
ESRLGLPLFVKPANQGSSVGVSKVANEAQYQQAVALAFEFDHKVVVEQGIKGREIECAVL
GNDNPQASTCGEIVLNSEFYAYDTKYIDDNGAQVVVPAQIPSEVNDKIRAIAIQAYQTLG
CAGMARVDVFLTADNEVVINEINTLPGFTNISMYPKLWQASGLGYTDLISRLIELALERH
TANNALKTTM
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atggaatgggtttttaagatggcgaaattgcgggtaggaatagtatttggcggtaagtcg
gcggaacatgaagtgtctttgcaatcagcgaaaaatatcgttgatgcgatcgataaaacc
cgcttcgacgtggtgctgttagggatagataaggcgggacaatggcatgttaacgatgcg
gaaaattatttgcagaatgcagacgatccggcacatatcgcgctacgtccttcggcaatc
agtctggcccaggtgcctggcaaacaccaacaccaattgattaacgcccagaacgggcag
ccgctaccgacggtagatgttatttttcctatcgtccacggtacgctgggcgaagacggc
tcattgcaggggatgctacgcgtcgcaaacttaccgtttgtcggttcagacgtgctgagc
tccgcagcctgcatggataaagacgtcgccaaacgactgctacgcgatgcaggactgaat
atcgccccgtttattacactcacccgaacgaatcgtcacgcgtttagttttgccgaggtt
gaatcccgtctgggactgccgctgttcgttaagcccgccaatcagggctcttcggtcggc
gtcagtaaagtcgctaacgaagcgcaatatcagcaggcggtcgcgctggctttcgaattc
gatcataaagtggtggtggagcaagggatcaaagggcgcgagatcgaatgcgccgtatta
ggtaacgataacccacaggccagcacctgcggcgaaatcgtactgaatagcgaattttac
gcctacgatactaagtatattgatgataacggcgcacaagttgtcgtgcctgcgcagatc
ccttccgaggtgaatgataagatccgcgcgatcgcgatccaggcttatcagacgctgggg
tgcgcgggtatggcgcgtgtcgatgtcttcttaacggcagacaatgaggtcgtgattaac
gagattaatacgctgccaggttttaccaatatcagtatgtatccaaaactctggcaggcg
agcggattgggctataccgatttgatcagccgcctgattgagctggcgctggaacgccat
acggcgaataacgccttaaaaaccacgatgtaa

DBGET integrated database retrieval system