KEGG   Salmonella enterica subsp. enterica serovar Newport USMARC-S3124.1: SN31241_13860Help
Entry
SN31241_13860     CDS       T02779                                 

Definition
(GenBank) Shikimate kinase 2
  KO
K00891  shikimate kinase [EC:2.7.1.71]
Organism
senn  Salmonella enterica subsp. enterica serovar Newport USMARC-S3124.1
Pathway
senn00400  Phenylalanine, tyrosine and tryptophan biosynthesis
senn01100  Metabolic pathways
senn01110  Biosynthesis of secondary metabolites
senn01130  Biosynthesis of antibiotics
senn01230  Biosynthesis of amino acids
Module
senn_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:senn00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SN31241_13860
Enzymes [BR:senn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.71  shikimate kinase
     SN31241_13860
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SKI AAA AAA_18 AAA_33 AAA_5 Cytidylate_kin2 AAA_16 AAA_14 AAA_25 Cytidylate_kin IPT AAA_28 AAA_23 RNA_helicase AAA_22 SpoVT_C ABC_tran Rad17 Sigma54_activ_2
Motif
Other DBs
NCBI-ProteinID: AGS28359
LinkDB All DBs
Position
1431838..1432383
Genome map
AA seq 181 aa AA seqDB search
MMQPLYLVGPRGCGKTTIGMALAQATGFRFADTDRWLQSHVQMSVADIVEKEGWGGFRAR
ETAALEAVSAPSTVVATGGGIILTEYNRRYMHRVGVVIYLCAPVSTLVNRLEAEPEADLR
PTLTGKPLSEEVREVLEQRDALYRETAHYIIDATKTPAQVVSEIIAALPPSTQRLQGDVY
T
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
atgatgcaacctctttatcttgttggcccgcggggctgtgggaaaaccaccatcggtatg
gcgctggcgcaggcaaccggtttccggtttgcagataccgaccgctggctgcaatcgcac
gtgcagatgagcgtcgctgatatcgttgaaaaagaaggctggggagggttccgcgcccgg
gaaaccgcggccctggaggcggtaagcgcgccttcgactgtcgtggcgacagggggcggt
attattctcacggagtataaccgacgttatatgcaccgtgttggcgtagtgatttatctg
tgcgcgccggtatccacgctggttaaccggcttgaggctgaacctgaagcggatctgcgc
ccgaccctcaccggcaagccgttgagcgaagaggttcgggaagtgcttgagcagcgtgac
gcgttgtatcgcgaaacggcacattacattattgacgcgacgaaaacgccggcccaggtc
gtttctgaaattattgcggcgctgccgccctcgacgcaacggttacagggagatgtctat
acttaa

DBGET integrated database retrieval system