KEGG   Salmonella enterica subsp. enterica serovar Newport USMARC-S3124.1: SN31241_19180Help
Entry
SN31241_19180     CDS       T02779                                 

Definition
(GenBank) D-alanyl-D-alanine carboxypeptidase DacC
  KO
K07258  serine-type D-Ala-D-Ala carboxypeptidase (penicillin-binding protein 5/6) [EC:3.4.16.4]
Organism
senn  Salmonella enterica subsp. enterica serovar Newport USMARC-S3124.1
Pathway
senn00550  Peptidoglycan biosynthesis
senn01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:senn00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    SN31241_19180
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:senn01002]
    SN31241_19180
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:senn01011]
    SN31241_19180
Enzymes [BR:senn01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     SN31241_19180
Peptidases and inhibitors [BR:senn01002]
 Serine peptidases
  Family S11: D-Ala-D-Ala carboxypeptidase A family
   SN31241_19180
Peptidoglycan biosynthesis and degradation proteins [BR:senn01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   SN31241_19180
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S11 PBP5_C Beta-lactamase2 Beta-lactamase CD52
Motif
Other DBs
NCBI-ProteinID: AGS28891
LinkDB All DBs
Position
1963596..1964798
Genome map
AA seq 400 aa AA seqDB search
MTQYASSLRSLAAGSVLLFLFASPVKAEEQTIAPPGVDARAWILMDYASGKVLAEGNADE
KLDPASLTKIMTSYVVGQALKAGKIKLTDMVTVGKDAWATGNPALRGSSVMFLKPGDQVS
VADLNKGIIIQSGNDACIALADYVAGSQESFIGLMNAYAKRLGLTNTTFQTVHGLDAPGQ
FSTARDMALLGKALIHDVPDEYAIHKEKEFTFNNIRQPNRNRLLWSTNLHVDGMKTGTTA
GAGYNLVASATQGDMRLISVVLGAKTDRIRFNESEKLLTWGFRFFETVTPIKPDATFVTQ
RVWFGDKREVNLGAGDAGSVTIPRGQLKNLKASFTLNEPQLTAPLKKGQVVGTIDFQLNG
KSIEQRPLMVMENVEEGGFFSRMWDFVLMKLHQWFGSWFS
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgacgcaatacgcttcttcccttcgtagcctcgcggcaggttcggttctcttattcctt
ttcgcttcgcctgtaaaggcagaggaacaaacgatcgcgccgccgggcgttgatgcgcga
gcctggatcttaatggattacgccagcggtaaagtactggcggaaggcaacgccgatgag
aaactcgaccctgccagtttgacaaaaattatgaccagctacgtggtgggccaggcgctg
aaggcagggaaaatcaagctgaccgatatggtgacggtgggcaaagatgcctgggcgacg
gggaacccggcgctacgtgggtcgtcggtgatgtttctgaagccaggcgatcaggtgtcg
gttgcggatcttaataaaggcatcatcattcagtcaggtaacgatgcctgtatcgcgctt
gccgactacgtcgccggaagccaggagtcctttatcggcctgatgaacgcctatgcgaaa
cgactggggttaaccaatacaaccttccagacggtacacggtcttgatgcgccagggcag
ttcagtaccgctcgcgatatggcgttgctcggcaaggccttgattcacgatgtgcctgac
gaatacgccattcataaagaaaaagaatttacttttaataatattcgtcaaccgaaccgc
aaccgcctgttgtggagcaccaatctgcatgtcgacggcatgaaaacggggacaacggct
ggcgctgggtataaccttgtcgcctccgccactcagggcgatatgcgcctgatctctgtc
gtgctgggggcgaaaacggaccgtattcgttttaatgagtcagaaaaactgctgacctgg
ggtttccgcttctttgaaacggtcacgccgattaaacctgacgcgacattcgtgacgcaa
cgggtctggtttggcgataagcgtgaggtcaatttgggggcgggcgatgcggggtctgtg
acgattccgcgtgggcagcttaaaaacctgaaggccagctttacgttgaacgaaccacag
ctcacggcgccgttgaagaaagggcaggttgtcggcaccatcgatttccagcttaacgga
aaatccattgagcaacgcccgttaatggtgatggaaaacgtcgaggaggggggatttttc
agccggatgtgggattttgtgctgatgaaactccatcagtggtttggcagttggttctcg
taa

DBGET integrated database retrieval system