KEGG   Salmonella enterica subsp. enterica serovar Newport USMARC-S3124.1: SN31241_26140Help
Entry
SN31241_26140     CDS       T02779                                 

Definition
(GenBank) zinc-type alcohol dehydrogenase-like protein
Organism
senn  Salmonella enterica subsp. enterica serovar Newport USMARC-S3124.1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C HI0933_like AlaDh_PNT_C TrkA_N Pyr_redox_2 DAO Peptidase_M55 Pyr_redox_3 Pyr_redox ADH_zinc_N_2 FAD_binding_2
Motif
Other DBs
NCBI-ProteinID: AGS29586
LinkDB All DBs
Position
complement(2641598..2642623)
Genome map
AA seq 341 aa AA seqDB search
MKVKAVFINKPGEVETRWVDYPHKKENEVLIKVDAAGICGSDIGAFRGTNPLVTYPRIIG
HEVTGIVLQEGAGMPDNIKEGDRVIVDPYIYCGHCYPCSVGRTNCCENLNVIGVHVDGAM
QEVVTHPAHLIHKIPDNVPSEMAPLAEPLTIALHALHRANVKAGEYVAIIGAGAIGLMAA
LSARHYKATPILIDIVEERLRYAQKLGVPYVLNAADDQVIDAIKNITHGTMAQVVIEASG
ANSAIRNTLDLASFAGRISFTGWPKQETSLPTNLITYKELDLRGSRTSAGEFDEALRMLS
TLEINPQDVVSKVVNLDEIPDAVKELDRYPERYLKINAVFH
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtcaaagctgtgttcattaataagcctggtgaagttgaaacccgctgggtggat
tatccccataagaaagaaaatgaagtattaattaaggttgatgctgcaggcatttgcgga
tcggatatcggggcttttcgtggaacgaacccactggttacttacccaagaattattggg
catgaagtgaccggaattgttcttcaggaaggcgccggaatgccggacaatattaaagaa
ggtgaccgcgtaattgttgacccctatatttattgtggtcactgctacccttgctctgtc
ggcagaactaattgttgtgaaaatttaaacgtcattggcgtgcatgtcgatggcgcaatg
caggaggtggttactcatcccgcacatttaattcataaaataccagataatgtgccttct
gaaatggcgccgctggcagaaccgctgaccatcgctctgcacgcgctgcatcgggcaaac
gttaaggctggggaatatgttgccatcatcggcgcgggggccattggtcttatggcggca
ttaagcgcgcgtcattacaaggcaacgcctattctgatcgatattgtggaagaaaggcta
cgctatgcgcaaaagcttggcgttccctatgtgctgaacgccgctgacgatcaggttatc
gacgctattaaaaatatcacccacggcaccatggcgcaggtcgtgatagaagcctccggc
gcaaatagcgctattcgaaatacgcttgatttagcatcgtttgctggtcgtatttcgttt
accggatggccaaaacaggaaacgtcgctgccgacgaacctgatcacctacaaagaactg
gatttacgcggttcccgcaccagtgccggtgaatttgatgaggcattacgcatgctgtca
acgctggagattaatccgcaagatgttgtcagtaaggtcgtcaatcttgatgagatccct
gatgcagttaaagaacttgatcgctatccggagcgctacttaaagattaatgctgttttc
cattga

DBGET integrated database retrieval system