KEGG   Salmonella enterica subsp. enterica serovar Newport USMARC-S3124.1: SN31241_27810Help
Entry
SN31241_27810     CDS       T02779                                 

Definition
(GenBank) reductase
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
senn  Salmonella enterica subsp. enterica serovar Newport USMARC-S3124.1
Pathway
senn00061  Fatty acid biosynthesis
senn00780  Biotin metabolism
senn01100  Metabolic pathways
senn01130  Biosynthesis of antibiotics
senn01212  Fatty acid metabolism
Module
senn_M00083  Fatty acid biosynthesis, elongation
senn_M00572  Pimeloyl-ACP biosynthesis, BioC-BioH pathway, malonyl-ACP => pimeloyl-ACP
Brite
KEGG Orthology (KO) [BR:senn00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    SN31241_27810
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    SN31241_27810
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    SN31241_27810
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:senn01004]
    SN31241_27810
Enzymes [BR:senn01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     SN31241_27810
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     SN31241_27810
Lipid biosynthesis proteins [BR:senn01004]
 Fatty acid synthase
  Component type
   SN31241_27810
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR
Motif
Other DBs
NCBI-ProteinID: AGS29753
LinkDB All DBs
Position
2813323..2814111
Genome map
AA seq 262 aa AA seqDB search
MGFLSGKRILVTGVASKLSIAYGIAQAMHREGAELAFTYQNDKLKGRVEEFAAQLGSSIV
LPCDVAEDASIDAMFAELGNVWPKFDGFVHSIGFAPGDQLDGDYVNAVTREGFKIAHDIS
SYSFVAMAKACRTMLNPGSALLTLSYLGAERAIPNYNVMGLAKASLEANVRYMANAMGPE
GVRVNAISAGPIRTLAASGIKDFRKMLAHCEAVTPIRRTVTIEDVGNSAAFLCSDLSAGI
SGEVVHVDGGFSIAAMNELELK
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgggttttctttccggtaagcgcattctggtcactggcgtggccagtaaactgtccatc
gcctacggtatcgcacaggcgatgcaccgcgaaggagctgaactggcgttcacctaccag
aacgacaaactgaaaggccgtgtagaagaatttgctgcccagctgggttccagcatcgtt
ttaccgtgtgatgtcgctgaagatgccagcattgacgctatgtttgcagagctgggtaac
gtttggccgaaatttgacggttttgtacactcgatcggtttcgcgcctggcgatcagctg
gacggcgattatgttaatgcggttacccgcgaaggctttaaaatcgctcacgatattagc
tcttacagctttgttgccatggcgaaagcctgccgcaccatgctgaatccgggttctgcg
ctgttgaccttgtcttatctgggagcggagcgcgccatcccgaactacaatgtcatgggt
ctggcgaaagcctctctggaagccaacgtgcgttatatggcaaacgctatgggaccggaa
ggggttcgcgtcaacgccatctctgcgggtccaatccgcacgctggcggcgtccggtatt
aaagacttccgtaaaatgctggcgcattgtgaagccgttacgccaattcgtcgcaccgtg
accattgaagatgtgggtaactcagcggcgtttctgtgttccgatctctcggcaggcatt
tctggcgaagtcgtccatgttgacggcgggttcagcattgcggcaatgaatgaactggaa
ctgaagtaa

DBGET integrated database retrieval system