KEGG   Salmonella enterica subsp. enterica serovar Newport USMARC-S3124.1: SN31241_36950
Entry
SN31241_36950     CDS       T02779                                 

Definition
(GenBank) Leucine-rich repeat protein
  KO
K23942  Gifsy-1 prophage leucine-rich repeat protein
Organism
senn  Salmonella enterica subsp. enterica serovar Newport USMARC-S3124.1
Pathway
senn05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:senn00001]
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    SN31241_36950
SSDB
Motif
Pfam: FNIP LRR_4
Other DBs
NCBI-ProteinID: AGS30667
LinkDB
Position
3754648..3756117
AA seq 489 aa
MKIGFQPAILQYAYTSNEATSNLELLNKWRIESPDIEKEERNSIYDKIIEANHTGSLSIT
AHHVTSIPVFPDNLSELNLSSCYTLESIPNLPDGLKSLTISGNQTIKISYFPDSLESLSI
DMQAYEENYTFPALPYGLKSFTACYGKFLPPLPPHLSSLSLQNFSEILCAELPYKLDKLD
LQNCPFLPLMKMLPEELKELSIELIRTVPGTVIDDILPDKLKKLSINFCDNIKLPVKLPV
NLKSINLSSRTPIAWEIPTCNLPAHIDISTDGYVKLNPEFLTRSDITFSNKPAGDVLSFQ
PGDVVYGLCKARDRVNTLVNSLYYFSKKDIIIQNTLTDAVWDRKNRAVFNKDEKIAERLN
DVQRGIFFREFLSQHKKYNITEDKYSDLSNEECWIKTSKAGLEFQTRLRERSVIFVIDNL
VDAISDIANKTGKHGNSITAHELRWVYRNRHDDLVKQNVKFFLNGEAISHEDVFSLVGWD
KYKPKNRNR
NT seq 1470 nt   +upstreamnt  +downstreamnt
atgaaaataggattccaaccagccatattgcaatatgcatatacaagtaacgaggcgaca
tcaaaccttgagttattaaataaatggagaatagaatccccagatattgagaaggaggag
cgtaatagtatttacgacaaaataatagaagcaaatcataccgggagcttatcaattact
gctcatcatgttacctctattccggtatttcctgataatttatccgaattgaatttatct
tcatgctatacactggagtctattccaaatcttcctgatgggttaaaaagtttaactata
tctggaaatcagaccattaaaatttcatatttcccagatagcttagagtcactatctata
gatatgcaggcatatgaagaaaattatactttccccgcattaccttatggattaaagagt
tttactgcatgctatggtaaatttttgcctccccttcctccgcatctatcttctttgtca
ttgcaaaatttctctgaaatattatgtgctgagttaccatataaattagataaattagat
ttacaaaattgccctttcttgccattaatgaaaatgttacctgaggagttaaaagaacta
agtattgaacttatacgaacagttcccggtactgttatagatgatattttgcctgataag
ctaaaaaaattaagtatcaacttttgtgataatattaaacttccagttaagcttcctgtt
aatttaaagtctatcaatttatcctcaaggacccctattgcatgggaaataccaacctgc
aatctgcctgcacatatagatattagtaccgatggttatgttaagcttaatcctgaattt
cttaccaggagtgatattacctttagtaacaaacctgcaggagatgtgttaagttttcag
cctggagatgtggtttatggtttatgtaaggcaagagatcgagtaaatactttagttaat
tcgttatattatttttcaaaaaaagatattattattcaaaatacattaacagatgcggtc
tgggacaggaagaatagagccgtgtttaataaagatgagaagatagcagaaagattgaat
gatgttcagagagggattttttttagagaatttttatctcaacataaaaaatacaatatt
accgaagataaatattcagacttatccaatgaggagtgctggataaaaacaagtaaagcc
ggtcttgaatttcaaacacgattgagggaacggtcagttatttttgtcattgacaattta
gttgatgctataagtgatatcgcaaataaaacaggaaagcatggtaattctattacagca
catgagctaagatgggtatatcggaatcgacatgatgatctggtaaaacaaaatgttaaa
ttttttcttaatggtgaggctatttcacacgaagatgttttttcattagttggttgggat
aaatataagcctaaaaatagaaatcgttga

DBGET integrated database retrieval system