KEGG   Salmonella enterica subsp. enterica serovar Newport USMARC-S3124.1: SN31241_44230Help
Entry
SN31241_44230     CDS       T02779                                 

Definition
(GenBank) D-alanyl-D-alanine carboxypeptidase dacB
  KO
K07259  serine-type D-Ala-D-Ala carboxypeptidase/endopeptidase (penicillin-binding protein 4) [EC:3.4.16.4 3.4.21.-]
Organism
senn  Salmonella enterica subsp. enterica serovar Newport USMARC-S3124.1
Pathway
senn00550  Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:senn00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    SN31241_44230
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:senn01002]
    SN31241_44230
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:senn01011]
    SN31241_44230
Enzymes [BR:senn01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     SN31241_44230
   3.4.21  Serine endopeptidases
    3.4.21.-  
     SN31241_44230
Peptidases and inhibitors [BR:senn01002]
 Serine peptidases
  Family S13: D-Ala-D-Ala peptidase C family
   SN31241_44230
Peptidoglycan biosynthesis and degradation proteins [BR:senn01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   SN31241_44230
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S13 Beta-lactamase2 Transpeptidase TrbL
Motif
Other DBs
NCBI-ProteinID: AGS31394
LinkDB All DBs
Position
4476325..4477758
Genome map
AA seq 477 aa AA seqDB search
MRFSRFIIGLTTSIAFSVQAANIDEYIKQLPAGANLALMVQKIGAPAPAIDYHSQQMALP
ASTQKVITALAALIQLGPDFRFTTTLETKGNVDNGILKGDVIARFGGDPTLRRQDIRNMV
ATLKKSGVTQIDGNVLIDTSIFASHDKAPGWPWNDLTQCFSAPPAAAIVDRNCFSVSLYS
AQKPNDLAFIRVASYYPVTMFSQVRTLPRGSADAQYCELDVVPGDLNRYTLTGCLPQRAD
PLPLAFAIQDGASYAGAILKQELKEAGITYRGTLLRQTQVNEPGTIVASKQSAPLHDLLK
IMLKKSDNMIADTVFRMIGHVRFNVPGTWRAGSDAVRQILRQQAGIDIGNTIIADGSGLS
RHNLIAPATMMQVLQYIAQHDNELNFISMLPLAGYDGSLQYRAGLHQAGVDGKVSAKTGS
LQGVYNLAGFITTASGQRMAFVQYLSGYAVPPADQRNRRIPLVRFESRLYKDIYQNN
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atgcgattttccagatttatcatcggattgaccaccagtatagcgttcagcgttcaggcc
gcgaatattgacgaatacatcaaacagcttccggccggcgccaacctcgcgctgatggtg
caaaagattggcgcgcccgcgccggctattgattatcatagtcagcagatggcgcttccc
gccagtacccaaaaggtgattaccgcgctggcggcgctgattcaactcggcccggatttc
cgttttacgaccacgctggagactaaaggcaacgtcgataacggcatcctgaaaggtgac
gtaattgcgcgcttcggtggcgatccaacgctaagacgtcaggatattcgcaatatggtc
gcgacgctgaaaaagtcaggcgtcacgcaaatcgacggcaatgtgcttatcgacacgtcg
attttcgccagccacgataaagcgccaggctggccgtggaacgacctgacgcagtgtttc
agcgcgcctcccgccgccgccattgttgaccgcaactgtttttctgtgtcgctttatagc
gcgcaaaaaccaaacgatttagcctttattcgcgtggcctcttattatccggtaacgatg
ttcagccaggtacggactctaccgcgcggttcggcagacgcgcagtattgcgagctggat
gttgtgcctggcgatttgaaccgttatacgcttaccggctgtttaccacagcgcgccgac
ccgctgccgctggcctttgctattcaggacggcgccagctacgcgggcgcgatcctcaag
caggaactgaaagaggccgggataacttaccgcggcacgctgctgcgccagacgcaggtt
aacgagcccggaacgatcgtcgccagtaaacagtcggcgccactgcacgatctgcttaag
attatgctgaaaaagtcagacaacatgatcgccgatactgtttttcggatgattggtcat
gtcaggtttaacgtgcctggcacctggcgggcgggatcggatgccgttcgccagattctg
cgccaacaggcgggaattgatatcggcaataccattattgccgacggttccggtctttct
cgccataatctgatcgctcccgccacgatgatgcaggtgctgcaatatatcgcccaacat
gataacgagctgaactttatctctatgctgccgctggcgggctatgatggttcattacaa
taccgcgccgggctgcatcaggcgggcgtagacggtaaggtttcagcgaaaaccgggtca
ctgcagggcgtgtataatctggcgggctttattaccaccgcaagcgggcaacggatggca
tttgtacagtatttgtccggctacgcggttccacctgccgatcagcgtaatcgacgtatt
ccgctggtacgcttcgagagtcgattgtacaaggatatttatcagaataactga

DBGET integrated database retrieval system