KEGG   Salmonella enterica subsp. enterica serovar Newport USMARC-S3124.1: SN31241_4440Help
Entry
SN31241_4440      CDS       T02779                                 

Definition
(GenBank) Elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
senn  Salmonella enterica subsp. enterica serovar Newport USMARC-S3124.1
Brite
KEGG Orthology (KO) [BR:senn00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:senn03012]
    SN31241_4440
   03029 Mitochondrial biogenesis [BR:senn03029]
    SN31241_4440
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:senn04147]
    SN31241_4440
Translation factors [BR:senn03012]
 Eukaryotic Type
  Elongation factors
   SN31241_4440
 Prokaryotic Type
   SN31241_4440
Mitochondrial biogenesis [BR:senn03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    SN31241_4440
Exosome [BR:senn04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   SN31241_4440
  Exosomal proteins of breast cancer cells
   SN31241_4440
  Exosomal proteins of colorectal cancer cells
   SN31241_4440
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 cobW
Motif
Other DBs
NCBI-ProteinID: AGS27419
LinkDB All DBs
Position
469264..470448
Genome map
AA seq 394 aa AA seqDB search
MSKEKFERTKPHVNVGTIGHVDHGKTTLTAAITTVLAKTYGGAARAFDQIDNAPEEKARG
ITINTSHVEYDTPTRHYAHVDCPGHADYVKNMITGAAQMDGAILVVAATDGPMPQTREHI
LLGRQVGVPYIIVFLNKCDMVDDEELLELVEMEVRELLSQYDFPGDDTPIVRGSALKALE
GDAEWEAKIIELAGFLDSYIPEPERAIDKPFLLPIEDVFSISGRGTVVTGRVERGIIKVG
EEVEIVGIKETQKSTCTGVEMFRKLLDEGRAGENVGVLLRGIKREEIERGQVLAKPGTIK
PHTKFESEVYILSKDEGGRHTPFFKGYRPQFYFRTTDVTGTIELPEGVEMVMPGDNIKMV
VTLIHPIAMDDGLRFAIREGGRTVGAGVVAKVLG
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
gtgtctaaagaaaaatttgaacgtacaaaaccgcacgttaacgtcggcaccatcggccac
gttgaccacggtaaaactaccctgaccgctgcaatcaccaccgtactggctaaaacctac
ggcggtgctgctcgtgcattcgaccagatcgataacgcgccggaagaaaaagcgcgtggt
atcaccatcaacacttctcacgttgaatacgataccccgacccgccactacgcacacgta
gactgcccggggcacgccgactatgttaaaaacatgatcaccggtgctgctcagatggac
ggcgcgatcctggttgttgctgcgactgacggcccgatgccgcagacccgtgagcacatc
ctgctgggtcgtcaggtaggcgttccgtacatcatcgtgttcctgaacaaatgcgacatg
gttgatgacgaagagctgctggaactggttgagatggaagttcgcgaactgctgtctcag
tacgacttcccgggcgacgacactccgatcgttcgtggttctgctctgaaagcgctggaa
ggcgacgcagagtgggaagcgaaaatcatcgaactggctggcttcctggattcttacatc
ccggaaccagagcgtgcgattgacaagccgttcctgctgccgatcgaagacgtattctcc
atctccggtcgtggtaccgttgttaccggtcgtgtagaacgcggtatcatcaaagtgggc
gaagaagttgaaatcgttggtatcaaagagactcagaagtctacctgtactggcgttgaa
atgttccgcaaactgctggacgaaggccgtgccggtgagaacgtaggtgttctgctgcgt
ggtatcaaacgtgaagaaatcgaacgtggtcaggtactggctaagccgggcaccatcaag
ccgcacaccaagttcgaatctgaagtgtacattctgtccaaagatgaaggcggccgtcat
actccgttcttcaaaggctaccgtccgcagttctacttccgtactactgacgtgactggt
accatcgaactgccggaaggcgtagagatggtaatgccgggcgacaacatcaaaatggtt
gttaccctgatccacccgatcgcaatggacgacggtctgcgtttcgcaatccgtgaaggc
ggccgtactgttggcgcgggcgttgttgctaaagttctgggctaa

DBGET integrated database retrieval system