KEGG   Salmonella enterica subsp. enterica serovar Enteritidis EC20090193: AU37_01070Help
Entry
AU37_01070        CDS       T03732                                 

Definition
(GenBank) transcriptional regulator
  KO
K02647  carbohydrate diacid regulator
Organism
seno  Salmonella enterica subsp. enterica serovar Enteritidis EC20090193
Brite
KEGG Orthology (KO) [BR:seno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:seno03000]
    AU37_01070
Transcription factors [BR:seno03000]
 Prokaryotic type
  Helix-turn-helix
   Other families
    AU37_01070
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Diacid_rec HTH_30 GGDEF_2 GAF_2
Motif
Other DBs
NCBI-ProteinID: AHP72593
LinkDB All DBs
Position
247900..249057
Genome map
AA seq 385 aa AA seqDB search
MAGWHLDTKMAQDIVARTMRIIDTNINVMDARGRIIGSGDRERIGELHEGALLVLSQGRV
VYIDNAVARHLHGVRQGINLPLRLEGEIVGVIGLTGEPEHLRKYGELVCMTAEMMLEQSR
LMHLLAQDSRLREELVMNLIQAEENTPALVEWAQRLGIDLNQPRVAAVVEVDSGQLGVDS
AMAELQQLQNALTTPERNNLIAIVSLTEMVVLKPALNSFGRWDAEDHRKRVEQLISRMKE
NGQLRFRVALGNYFTGPGSIARSYRTARTTMMVGKQRMPESRSYFYQDLMLPVLLDSLRG
GWQANELARPLVKLKAMDNNGLLRRTLTAWFRHNVQPLATSKALFIHRNTLEYRLNRISE
LTGLDLGNFDDRLLLYVTLQLDEQR
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atggctggctggcatcttgataccaaaatggcgcaggatatcgtggcgcgcactatgcgc
atcatcgataccaatatcaacgtaatggatgcccgcgggcgtattatcggcagcggcgat
cgggaacgtattggtgaattgcacgaaggcgcgctgttagtgctgtcgcagggccgggtt
gtgtatattgacaacgccgtggcgcgacacctgcacggggtgcgtcaggggattaatctt
cccttacgtcttgagggcgaaattgtcggcgtgatcggcctcaccggcgaaccagagcat
ctgcgtaaatatggcgaactggtgtgtatgactgccgaaatgatgctggagcagtcgcgg
ttaatgcaccttttggcgcaggatagccgtttgcgcgaagagctggtgatgaacctgatt
caggccgaagaaaatacgccggcgctggtggaatgggcgcagcgtttggggatcgatttg
aaccagccgcgtgtggcggcggtggtggaagtcgacagcggccagcttggcgtcgatagc
gcaatggcggaacttcagcagttgcagaatgcgcttaccacgccggagcgtaacaacctg
atagccattgtttctctcaccgagatggtggtgctcaaacccgccttaaactcgtttggt
cgctgggatgctgaagatcatcgtaagcgcgtagagcagcttatctcgcgaatgaaagag
aatggtcagctacgttttcgcgtggcgctgggcaattactttaccgggccgggcagtatt
gcacgttcataccgcacggcgcgcactacgatgatggtcggcaaacagcggatgccagaa
agccgcagctatttttatcaggatttgatgctgccggttctgttagatagcctgcgtggc
ggctggcaggccaatgagctggcgcgcccgctggtaaaactcaaagcgatggataacaac
gggttattacgtcggacgctgacggcgtggtttcgccataatgtccagccgctggcgacc
tctaaggcgctgtttattcatcgtaacacgctggaatatcggctaaatcgtatttcggaa
ctgaccgggctggatttgggaaattttgacgatcggctgttgctgtatgtgacgctacaa
ttggatgaacagcgttaa

DBGET integrated database retrieval system