KEGG   Salmonella enterica subsp. enterica serovar Enteritidis EC20090193: AU37_03720Help
Entry
AU37_03720        CDS       T03732                                 

Gene name
gpmA
Definition
(GenBank) phosphoglyceromutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
seno  Salmonella enterica subsp. enterica serovar Enteritidis EC20090193
Pathway
seno00010  Glycolysis / Gluconeogenesis
seno00260  Glycine, serine and threonine metabolism
seno00680  Methane metabolism
seno01100  Metabolic pathways
seno01110  Biosynthesis of secondary metabolites
seno01120  Microbial metabolism in diverse environments
seno01130  Biosynthesis of antibiotics
seno01200  Carbon metabolism
seno01230  Biosynthesis of amino acids
Module
seno_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
seno_M00002  Glycolysis, core module involving three-carbon compounds
seno_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:seno00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AU37_03720 (gpmA)
  09102 Energy metabolism
   00680 Methane metabolism
    AU37_03720 (gpmA)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    AU37_03720 (gpmA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:seno04131]
    AU37_03720 (gpmA)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:seno04147]
    AU37_03720 (gpmA)
Enzymes [BR:seno01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     AU37_03720 (gpmA)
Membrane trafficking [BR:seno04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    AU37_03720 (gpmA)
Exosome [BR:seno04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   AU37_03720 (gpmA)
  Exosomal proteins of melanoma cells
   AU37_03720 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: AHP73081
LinkDB All DBs
Position
complement(795511..796263)
Genome map
AA seq 250 aa AA seqDB search
MAVTKLVLVRHGESQWNKENRFTGWYDVDLSEKGVSEAKAAGKLLKEEGFSFDFAYTSVL
KRAIHTLWNVLDELDQAWLPVEKSWKLNERHYGALQGLNKAETAEKYGDEQVKQWRRGFA
VTPPELTKDDERYPGHDPRYAKLSEKELPLTESLALTIDRVIPYWNDTILPRMKSGERVI
IAAHGNSLRALVKYLDNMSEDEILELNIPTGVPLVYEFDENFKPLKHYYLGNADEIAAKA
AAVANQGKAK
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atggctgtaactaagctggttctggtacgtcacggtgaaagtcaatggaacaaagagaac
cgtttcaccggctggtatgatgttgacctgtctgaaaaaggcgtaagcgaagcaaaagca
gcgggtaaactgctaaaagaagaaggtttcagctttgattttgcctacacttccgtactg
aaacgcgctatccatacgctgtggaacgtactggatgaactggatcaagcgtggctgccg
gtggaaaaatcctggaaactcaatgaacgtcactatggcgcgttgcaggggctgaataaa
gcggaaacggcagaaaaatatggtgacgagcaggttaaacagtggcgccgcggttttgcc
gtgacgccgccggaactgaccaaagatgatgagcgttatccgggtcacgatccacgttat
gccaaactgagcgagaaagagctgccgttgaccgaaagtctggcgctgaccatcgaccgc
gttattccttactggaacgacaccatcctgccgcgtatgaagagcggtgagcgcgtgatc
atcgccgctcacggtaactcattgcgtgcgctggtgaaatacctggataacatgagtgaa
gatgagatccttgagttaaacatcccgaccggcgtgccgctggtgtatgagttcgacgaa
aacttcaagccgctcaaacattactatctgggcaacgctgacgaaatcgccgcgaaagcg
gctgccgtggcgaatcagggtaaagcgaagtaa

DBGET integrated database retrieval system