KEGG   Salmonella enterica subsp. enterica serovar Enteritidis EC20090193: AU37_06855Help
Entry
AU37_06855        CDS       T03732                                 

Definition
(GenBank) exoribonuclease II
  KO
K01147  exoribonuclease II [EC:3.1.13.1]
Organism
seno  Salmonella enterica subsp. enterica serovar Enteritidis EC20090193
Brite
KEGG Orthology (KO) [BR:seno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:seno03016]
    AU37_06855
Enzymes [BR:seno01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.13  Exoribonucleases producing 5'-phosphomonoesters
    3.1.13.1  exoribonuclease II
     AU37_06855
Transfer RNA biogenesis [BR:seno03016]
 Prokaryotic type
  3'processing and CCA adding factors
   3'processing factors
    AU37_06855
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RNB OB_RNB S1 CSD2
Motif
Other DBs
NCBI-ProteinID: AHP73677
LinkDB All DBs
Position
complement(1420401..1422335)
Genome map
AA seq 644 aa AA seqDB search
MFQDNPLLAQLKQQLHSQTPRAEGVVKATEKGFGFLEVDAQKSYFIPPPQMKKVMHGDRI
VAVIHTEKERESAEPEELIEPFLTRFVGKVQGKNDRLSIVPDHPLLKDAIPCRAARGVQH
EFKEGDWAVAEMRRHPLKGDRSFYADLTQYITFADDHFVPWWVTLARHNLEKEAPNGVAT
EMLDEGLERQDLTALNFVTIDSASTEDMDDALYAEELADGRLQLTVAIADPTAWIAEGSK
LDNAAKIRAFTNYLPGFNIPMLPRELSDDLCSLRANEVRPALACRMIISADGTIDDDIAF
FAATIESKAKLAYDNVSDWLENNGTWQPDNEGIAQQIRLLHRICLSRSEWRHHHALVFKD
RPDYRFVLGEKGEVLDIVAEPRRIANRIVEESMIAANLCAARVLRDKLGFGIYNVHTGFD
PANADALAALLKTHGLHVDAEEVLTLEGFCKLRRELDAQPSGFLDSRIRRFQSFAEISTE
PGPHFGLGLEAYATWTSPIRKYGDMINHRLLKAVIKGEAIARPQEDITQQMAERRRLNRM
AERDVGDWLYARFLNDKAGTNTRFAAEIIDVSRGGMRVRLVDNGAIAFIPAPFLHAVRDE
LVCSQENGTVQIKGETVYKVTDVIDVTIAEVRMETRSIIARPAA
NT seq 1935 nt NT seq  +upstreamnt  +downstreamnt
atgtttcaggacaacccgctgctagcgcagcttaaacagcaactgcattcccagacgccg
cgcgctgaaggggtcgtaaaagccacggaaaaaggctttggcttccttgaggttgacgcg
caaaaaagctatttcattcctccgccgcagatgaaaaaagtgatgcatggcgatcgtatc
gtcgcggtcatccacacggaaaaagaacgtgagtctgccgagccggaagaactgatcgaa
ccgttcctgacgcgttttgtgggaaaagttcagggtaaaaatgaccgcctgtccatcgtg
ccggatcatccgttgctgaaagacgcgattccctgccgcgccgcgcgcggcgttcagcat
gagttcaaagaaggtgactgggcggttgccgaaatgcgccgccatccgcttaaaggcgac
cgttcgttttacgccgatttaacgcagtacatcacctttgccgacgatcactttgttccc
tggtgggttacgcttgcccgccataacctggaaaaagaagcgccgaacggcgtagcgacg
gagatgctggacgaagggctggagcgtcaggatctgaccgcgctgaatttcgtcactatc
gatagcgccagcactgaagatatggatgacgcgctatatgctgaggaattagcggacggc
agactccagcttacggtggctatcgccgatcctaccgcctggattgccgaaggcagtaag
ctggataacgccgcgaaaattcgcgccttcaccaactacctgccgggcttcaatattcct
atgctgccacgtgagctgtctgacgatctgtgctcactgcgcgccaacgaagtgcgtccg
gcgctcgcctgtcgcatgataatctccgcggacggcaccattgacgatgatatcgccttt
tttgcggccaccatcgaatcgaaggccaagctggcgtacgacaatgtctccgactggctg
gaaaataacggcacctggcagccggataacgaaggcattgcccagcagattcgtctgttg
caccgtatttgcctaagccgcagtgagtggcgtcatcatcatgcgttagtctttaaagac
cgcccggattaccgctttgtgcttggcgaaaaaggcgaagtactggatattgtggcggaa
ccgcgccgtatcgctaaccgtatcgtagaagagtcgatgatcgccgctaacctttgcgcc
gcgcgcgtactgcgcgataagctcggtttcggtatttacaacgtacatacgggcttcgat
cccgcgaatgccgacgcgctggccgcgctgctgaaaacgcatggtctgcatgtcgatgcc
gaagaggtgctgacgctggaaggcttctgtaaactgcgtcgcgaactggatgcgcagccc
tccggtttccttgacagccgcattcgtcgcttccagtcttttgcggaaatcagcaccgag
ccggggccgcatttcggtcttggtcttgaggcttacgccacctggacctctcctatccgt
aagtatggcgatatgattaaccatcgcctgctgaaagcggtcatcaagggggaggctatt
gcgcgtccgcaggaagatatcacccagcaaatggcggaacgccgtcgcctgaaccgcatg
gcggagcgcgatgtcggcgactggttatatgcacgcttccttaacgataaggcggggaca
aatacccgtttcgcggcagaaattattgacgtcagccgcggtggtatgcgtgtgcgactg
gtcgataacggcgctatcgcctttatccctgccccgttcctgcacgccgttcgcgatgaa
ctggtatgcagccaggaaaacggtacggtacagattaaaggtgagacggtttataaagtg
acggatgtcattgatgtcactattgcggaagttcgcatggaaacccgcagcattattgcc
cgaccggcagcgtaa

DBGET integrated database retrieval system