KEGG   Salmonella enterica subsp. enterica serovar Enteritidis EC20090193: AU37_12455Help
Entry
AU37_12455        CDS       T03732                                 

Definition
(GenBank) transketolase
  KO
K00615  transketolase [EC:2.2.1.1]
Organism
seno  Salmonella enterica subsp. enterica serovar Enteritidis EC20090193
Pathway
seno00030  Pentose phosphate pathway
seno01100  Metabolic pathways
seno01110  Biosynthesis of secondary metabolites
seno01120  Microbial metabolism in diverse environments
seno01130  Biosynthesis of antibiotics
seno01200  Carbon metabolism
seno01230  Biosynthesis of amino acids
Module
seno_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
seno_M00007  Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:seno00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    AU37_12455
  09109 Metabolism of terpenoids and polyketides
   01051 Biosynthesis of ansamycins
    AU37_12455
Enzymes [BR:seno01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.1  transketolase
     AU37_12455
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transketolase_N Transket_pyr Transketolase_C TPP_enzyme_C E1_dh
Motif
Other DBs
NCBI-ProteinID: AHP74733
LinkDB All DBs
Position
2580980..2582980
Genome map
AA seq 666 aa AA seqDB search
MSRKDLANAIRALSMDAVQKANSGHPGAPMGMADIAEVLWNDFLKHNPTDPTWYDRDRFI
LSNGHASMLLYSLLHLTGYDLPLEELKNFRQLHSKTPGHPEIGYTPGVETTTGPLGQGLA
NAVGLAIAERTLGAQFNRPDHEIVDHYTYVFMGDGCLMEGISHEVCSLAGTLGLGKLIGF
YDHNGISIDGETEGWFTDDTAKRFEAYHWHVVYDIDGHDPEAVKKAILEAQSVKDKPSLI
ICRTVIGFGSPNKAGKEESHGAALGEEEVALTRQKLGWHHPAFEIPKEIYRAWDGREKGE
KAQQQWQEKFAAYEKAYPELAAEFTRRMSGGLPEAWESATQKFINDLQANPAKIATRKAS
QNTLNAYGPLLPELLGGSADLAPSNLTIWKGSTSLKEDPAGNYIHYGVREFGMTAIANGI
AHHGGFVPYTATFLMFVEYARNAARMAALMKARQIMVYTHDSIGLGEDGPTHQAVEQLAS
LRLTPNFSTWRPCDQVEAAVGWKLAIERQHGPTALILSRQNLAQVERTPEQVKAIARGGY
ILKDSGGKPDIILIATGSEMEITLQAAEKLTGEGHNVRVVSLPSTDIFDAQDEAYRESVL
PAHVTARVAVEAGIADYWYKYVGLKGAIIGMTGYGESAPADKLFPYFGFTVENIVEKARR
VLNIKG
NT seq 2001 nt NT seq  +upstreamnt  +downstreamnt
atgtcccgtaaagaccttgccaatgcgattcgtgcgctgagcatggatgccgttcaaaaa
gccaattccgggcaccccggcgcgccgatggggatggcggatatcgctgaagtgctatgg
aacgattttcttaaacataaccccaccgatccaacctggtatgaccgtgaccgttttatc
ctttccaacggtcacgcctccatgctgctctatagtctgctgcatttaaccggttatgac
ctgccgctggaggagttaaaaaacttccgtcaactgcactctaaaacgccaggtcacccg
gagattggctatacgcccggcgttgaaaccaccaccggaccgctgggccaggggctggcg
aatgccgtcgggctggcgattgccgagcgtacgttaggcgcacagttcaaccggccggac
catgagattgtcgaccactacacctatgtctttatgggcgacggctgtctgatggagggg
atctcgcatgaggtgtgttcgctggctggtacgctgggactgggcaaactgatcggcttt
tacgatcacaacggcatctccattgatggcgaaaccgaaggctggtttaccgacgatacc
gccaaacgttttgaagcctaccactggcatgtcgtatatgacattgacgggcacgatccg
gaggcggtgaaaaaagccattctcgaagcccagagcgtaaaagataaaccttcgctaatt
atctgtcggacggtgataggttttggctcgccgaataaagccgggaaggaggagtcgcac
ggcgcggcgctgggcgaagaagaggtggcgctgactcgccagaagctgggatggcatcat
ccggcgtttgagatcccaaaagaaatttaccgcgcgtgggatggccgtgaaaaaggcgag
aaagcgcagcagcagtggcaggaaaagtttgctgcttatgagaaggcttatcctgagctg
gccgcggagtttacccgccggatgagcggcggactgccggaggcatgggaatccgccacg
caaaaatttattaacgacttgcaggctaatccggccaaaatcgccacccgtaaagcatcg
caaaatacgctcaatgcctacggtcccctgttgccggaactgttgggcggatcggcggat
ctggcgccgagcaacctgactatctggaaaggttcgacctcgttgaaagaggatccggca
ggtaattatattcactatggcgtgcgcgaattcggcatgaccgccattgccaacggcatc
gcccatcacggcggctttgtaccgtataccgccacgtttctgatgtttgtcgaatatgcg
cgtaacgcggcgcgtatggcggccttaatgaaagcccggcagattatggtctatacccac
gactccatcggtttaggcgaagatggcccgacgcaccaggccgtggaacaactggcgagc
ctgcgcttaacgccaaacttcagcacctggcgtccctgcgatcaggttgaggcggcggtc
ggctggaagctggccattgaacgtcagcacgggccgacggcgttgattctctcgcggcaa
aatctggcgcaggtggaacgcacgccggaacaggtgaaagcgattgcccgcggcggttat
attctgaaagatagcggcggcaagccggatatcattctgatcgctaccggatcggaaatg
gaaattaccctccaggcggcggaaaaattgactggcgaggggcataacgttcgcgtggtg
tcgttgccttcaacggatattttcgatgcgcaggacgaggcatatcgcgaatctgtgcta
ccggcgcacgtgaccgcccgcgtcgcggtggaagccggtatagccgactactggtataaa
tatgttggcctaaaaggcgcaattatcggcatgacgggatacggtgaatccgccccggct
gacaaactgttcccgtattttggctttaccgtggaaaatattgtagaaaaagcccgccgg
gtgctgaacatcaaaggctaa

DBGET integrated database retrieval system