KEGG   Salmonella enterica subsp. enterica serovar Enteritidis EC20090193: AU37_15865Help
Entry
AU37_15865        CDS       T03732                                 

Definition
(GenBank) LysR family transcriptional regulator
Organism
seno  Salmonella enterica subsp. enterica serovar Enteritidis EC20090193
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LysR_substrate HTH_1 MarR_2 HTH_20
Motif
Other DBs
NCBI-ProteinID: AHP75385
LinkDB All DBs
Position
complement(3287975..3288871)
Genome map
AA seq 298 aa AA seqDB search
MAKERALTLEALRVMDAIDRRGSFAAAADELGRVPSALSYTMQKLEEELDVVLFDRSGHR
TKFTNVGRMLLERGRVLLEAADKLTTDAEALARGWETHLTLVTEALVPTPAFFPLIDRLA
AKANTQLSLITEVLAGAWERLEQGRADIVIAPDMHFRSSSEINSRKLYSLMNVYVAAPDH
PIHQEPEPLSEVTRVKYRGVAVADTARERPVLTVQLLDKQPRLTVSTIEDKRQALLAGLG
VATMPYSMVEQDIAEGRLRVVSPESTSEIDIIMAWRRDSMGEAKAWCLREIPKLFAGK
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atggctaaagagagagcgctgacgcttgaagcattgcgtgtgatggacgccattgaccgc
cggggcagttttgccgcagcggctgatgagttggggcgggtgccctccgcgctgagttac
accatgcagaagctggaagaagagttggacgttgtactgttcgatcgctccggccatcgt
acaaaattcaccaacgtcggacgtatgctgctggaacgcgggcgggtattgctggaagcg
gcagacaagttaacgacggatgctgaagcgttggcccgcggttgggaaacgcatctgacg
ctggtcactgaagctctggtaccgacgcctgctttttttccgctgatcgaccggctggcc
gctaaagccaatacgcagctttcattgattaccgaagtactggctggcgcatgggagcgg
cttgagcagggacgggcggatatcgttatcgccccggatatgcattttcgatcgtcgtcg
gaaattaactcccgtaagttgtattcgttaatgaatgtgtatgtcgccgcgcctgaccac
cctattcatcaggagccggagccgctttcggaagtgacgcgggttaaataccgcggcgta
gcggtagcggataccgcgcgcgagcggccggtattaacggtgcaactgctggataagcag
ccacgtctgacggtaagcacgattgaagataaacgtcaggcgctgctggccgggcttggc
gtcgcgactatgccatattcgatggtggaacaggatattgccgaagggcggctacgcgtg
gtcagcccggaatcgaccagcgaaatcgatattattatggcctggcggcgcgacagtatg
ggggaggcaaaagcctggtgcctgcgggaaatacctaagctattcgccggaaaataa

DBGET integrated database retrieval system