KEGG   Salmonella enterica subsp. enterica serovar Enteritidis EC20090193: AU37_17150Help
Entry
AU37_17150        CDS       T03732                                 

Gene name
hslO
Definition
(GenBank) molecular chaperone Hsp33
  KO
K04083  molecular chaperone Hsp33
Organism
seno  Salmonella enterica subsp. enterica serovar Enteritidis EC20090193
Brite
KEGG Orthology (KO) [BR:seno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:seno03110]
    AU37_17150 (hslO)
Chaperones and folding catalysts [BR:seno03110]
 Heat shock proteins
  HSP33
   AU37_17150 (hslO)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HSP33
Motif
Other DBs
NCBI-ProteinID: AHP75628
LinkDB All DBs
Position
3534245..3535123
Genome map
AA seq 292 aa AA seqDB search
MPQHDQLHRYLFENFAVRGELVTVSETLQQILDNHTYPQPVKTVLAELLVATSLLTATLK
FAGDITVQLQGDGPLSLAVINGNNQQQMRGVARVQGDIPDNADLKTLVGNGYLVITITPE
EGERYQGVVGLEGDTLAACLEDYFLRSEQLPTRLFIRTGDVDGKPAAGGMLLQVMPAQNA
QAEDFDHLAMLTETIKSEELLTLPANDVLWRLYHEEEVTLYDPQDVEFKCTCSRERCAGA
LKTLPDEEVDSILAEEGEIDMHCDYCGNHYLFNAMDIAEIRNNASPADPQVH
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atgccgcaacatgaccaattacatcgttatctgtttgaaaactttgccgttcgcggcgag
ctggtgaccgtttcggaaaccttgcaacagatcctcgacaatcatacctacccgcagccg
gtgaaaaccgtactggccgaactgctggtcgccactagcctgctgaccgcgacgctgaag
tttgccggcgacattacggtacagctccagggcgacgggccgttaagcctggcggtgatc
aatggcaataatcagcagcagatgcgcggcgtggctcgcgttcagggcgacatccctgac
aatgcggatctcaaaacgctggttggcaacggctatctggtgatcaccattacgccggaa
gagggtgaacgctatcagggcgtggtgggtctggaaggcgatactctggcggcgtgcctg
gaagattacttcctgcgctccgagcagttgccgacgcgcctgtttatccgtaccggcgat
gtcgacggtaaaccggcggcaggtggaatgttgcttcaggtgatgccggcacagaacgcg
caggcggaggatttcgaccatctggctatgttgacggaaaccattaaaagcgaagagctg
ctgacgttaccggcaaatgacgtgctgtggcgtttgtatcacgaagaagaagtcacactc
tacgatccgcaagatgttgagttcaaatgcacctgttcacgcgaacgttgcgcgggcgcg
ctgaaaacattgccggatgaagaagtggacagcattctggcggaagaaggcgaaatcgat
atgcactgcgattactgcggcaatcattacctgttcaatgcgatggatatcgcggagatc
cgtaacaacgcctctcctgccgatccacaggttcactaa

DBGET integrated database retrieval system